Target General Infomation
Target ID
T64001
Former ID
TTDR00538
Target Name
Epidermal growth factor receptor III
Gene Name
mCG_140518
Synonyms
Epidermal growth factor receptor isoform 3; Mus musculus adult male liver cDNA, RIKEN full-length enriched library, clone:1300003K07 product:epidermal growth factor receptor, full insert sequence; Mus musculus adult male liver cDNA, RIKEN full-length enriched library, clone:1300005M11 product:epidermal growth factor receptor, full insert sequence; Mus musculus adult male liver cDNA, RIKEN full-length enriched library, clone:1300008I23 product:epidermal growth factor receptor, full insert sequence; mCG_140518
Target Type
Research
UniProt ID
Sequence
MRPSGTARTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMYNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALA
ILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMDTIQWRDIVQNVFMSNMSMDL
QSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSHRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGPDYYEVEEDGIRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
YCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPDNWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKL
FGTPNQKTKIMNNRAEKDCKAVNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVEKCN
ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGIM
GENNTLVWKYADANNVCHLCHANCTYGCAGPGLQGCEVWPSGYVQWQWILKTFWI
References
Ref 1587926URL: https://www.ebi.ac.uk/chembl/ The ChEMBL database in 2017

If you find any error in data or bug in web service, please kindly report it to Dr. Wang and Dr. Li.