Target Information

Target General Infomation
Target ID
T83875
Former ID
TTDS00289
Target Name
Amine oxidase [flavin-containing] A
Gene Name
MAOA
Synonyms
MAO-A; Monoamine oxidase; Monoamine oxidase A; MAOA
Target Type
Successful
Disease Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42]
Alzheimer disease [ICD9: 331; ICD10: G30]
Alcohol use disorders [ICD9: 303; ICD10: F10.2]
Depression [ICD9: 311; ICD10: F30-F39]
Epilepsy [ICD10: G40]
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32]
Mood disorder [ICD10: F30-F39]
Major depressive episode without melancholia [ICD10: F30-F39]
Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0]
Parkinson's disease; Major depressive disorder [ICD9:332, 296.2, 296.3, 710.0; ICD10: G20, F32, F33, M32]
Vitiligo [ICD9: 709.01; ICD10: L80]
Function
Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.
BioChemical Class
Oxidoreductases acting on CH-NH2 group of donors
Target Validation
T83875
UniProt ID
P21397
EC Number
EC 1.4.3.4
Sequence
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Drugs and Mode of Action
Drug(s) Clorgyline Drug Info Approved Parkinson's disease; Major depressive disorder [537290], [541746], [551871]
Isocarboxazid Drug Info Approved Depression [538453], [542218]
Moclobemide Drug Info Approved Depression [536361], [542451]
Tranylcypromine Drug Info Approved Major depressive episode without melancholia [551871]
Psoralen Drug Info Phase 3 Discovery agent [524054]
TRYPTAMINE Drug Info Phase 3 Discovery agent [521730], [538764]
CHF-3381 Drug Info Phase 2 Neuropathic pain [529017], [536374]
CX157 Drug Info Phase 2 Mood disorder [523264]
Ladostigil Drug Info Phase 2 Alzheimer disease [531772]
PIPERINE Drug Info Phase 1/2 Vitiligo [523529], [539613]
Desoxypeganine Drug Info Phase 1 Alcohol use disorders [529540]
Befloxatone Drug Info Discontinued in Phase 3 Major depressive disorder [541747], [544889]
Brofaromine Drug Info Discontinued in Phase 2 Anxiety disorder [544708]
CS-722 Drug Info Discontinued in Phase 2 Epilepsy [545373]
ESUPRONE Drug Info Discontinued in Phase 2 Major depressive disorder [545896]
RS-8359 Drug Info Discontinued in Phase 2 Major depressive disorder [544693]
BW-1370U87 Drug Info Discontinued in Phase 1 Major depressive disorder [545298]
Bifemelane Drug Info Terminated Alzheimer disease [533445]
E-2011 Drug Info Terminated Anxiety disorder [545345]
Inhibitor (+/-)-2-(4'-Benzyloxyphenyl)thiomorpholine Drug Info [530683]
(+/-)-2-(4'-Butoxyphenyl)thiomorpholin-5-one Drug Info [530683]
(+/-)-2-(4'-Butoxyphenyl)thiomorpholine Drug Info [530683]
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholin-5-one Drug Info [530683]
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholine Drug Info [530683]
(+/-)-2-(4'-Methoxyphenyl)thiomorpholin-5-one Drug Info [530683]
(+/-)-2-(4'-Methoxyphenyl)thiomorpholine Drug Info [530683]
(+/-)-2-(4'-Propoxyphenyl)thiomorpholin-5-one Drug Info [530683]
(+/-)-2-(4'-Propoxyphenyl)thiomorpholine Drug Info [530683]
(+/-)-2-Phenylthiomorpholin-5-one Drug Info [530683]
(+/-)-2-Phenylthiomorpholine Drug Info [530683]
(6-Benzyloxy-2-naphthyl)-2-aminopropane Drug Info [529986]
(6-Butoxy-2-naphthyl)-2-aminopropane Drug Info [529986]
(6-Ethoxy-2-naphthyl)-2-aminopropane Drug Info [529986]
(6-Methoxy-2-naphthyl)-2-aminopropane Drug Info [529986]
(6-methylthio-2-naphthyl)isopropylamine Drug Info [529986]
(6-Propoxy-2-naphthyl)-2-aminopropane Drug Info [529986]
(7-Benzyloxy-2-oxo-2H-chromen-4-yl)acetonitrile Drug Info [530434]
(E)-5-(3-Chlorostyryl)isatin Drug Info [530056]
(E)-5-(3-Fluorostyryl)isatin Drug Info [530056]
(E)-5-Styrylisatin Drug Info [530056]
(R)-Indan-1-yl-methyl-prop-2-ynyl-amine Drug Info [526455]
(R,S)-N-(R-phenylethyl)-1H-pyrrole-2-carboxamide Drug Info [528641]
(R/R)BEFLOXATONE Drug Info [526287]
(S)-2-amino-1-(4-butylthiophenyl)-propane Drug Info [528855]
(S)-2-amino-1-(4-ethylthiophenyl)-propane Drug Info [528855]
(S)-2-amino-1-(4-methylthiophenyl)-propane Drug Info [528855]
(S)-2-amino-1-(4-propylthiophenyl)-propane Drug Info [528855]
1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole Drug Info [526994]
1-(1-Naphthyl)-2-aminopropane Drug Info [529986]
1-(2-Naphthyl)-2-aminopropane Drug Info [529986]
1-(3-(4-chlorobenzyl)quinoxalin-2-yl)hydrazine Drug Info [527928]
1-(3-benzyl-6,7-dichloroquinoxalin-2-yl)hydrazine Drug Info [527928]
1-(3-benzylquinoxalin-2-yl)hydrazine Drug Info [527928]
1-(4-(benzyloxy)phenyl)propan-2-amine Drug Info [529986]
1-(4-butoxyphenyl)propan-2-amine Drug Info [529986]
1-(4-ethoxyphenyl)propan-2-amine Drug Info [529986]
1-(4-propoxyphenyl)propan-2-amine Drug Info [529986]
2,3,4,5-Tetrahydro-1H-pyrido[4,3-b]indole Drug Info [526993]
2-(2-cycloheptylidenehydrazinyl)-4-phenylthiazole Drug Info [551222]
2-(2-cyclopentylidenehydrazinyl)-4-phenylthiazole Drug Info [551222]
2-(3,4-dimethoxyphenyl)-4,5-dihydro-1H-imidazole Drug Info [529853]
2-(3-benzylquinoxalin-2-ylamino)ethanol Drug Info [527928]
2-(4,5-dihydro-1H-imidazol-2-yl)quinoline Drug Info [529853]
2-(4-methoxyphenyl)-4,5-dihydro-1H-imidazole Drug Info [529853]
2-(5-phenyl-furan-2-yl)-4,5-dihydro-1H-imidazole Drug Info [528409]
2-(naphthalen-2-yl)-4,5-dihydro-1H-imidazole Drug Info [529853]
2-Amino-1-(4-methylthiophenyl)propane Drug Info [529986]
2-BFi Drug Info [525733]
2-Bromo-N-(2-morpholinoethyl)nicotinamide Drug Info [530675]
2-Chloro-N-(2-morpholinoethyl)nicotinamide Drug Info [530675]
2-Chloro-N-(3-morpholinopropyl)nicotinamide Drug Info [530675]
2-Furan-2-yl-4,5-dihydro-1H-imidazole Drug Info [526918]
2-oxo-N-m-tolyl-2H-chromene-3-carboxamide Drug Info [530001]
2-oxo-N-p-tolyl-2H-chromene-3-carboxamide Drug Info [530001]
2-oxo-N-phenyl-2H-chromene-3-carboxamide Drug Info [530001]
2-Phenethyl-4,5-dihydro-1H-imidazole Drug Info [526918]
2-Phenoxymethyl-4,5-dihydro-1H-imidazole Drug Info [526918]
2-phenyl-5H-indeno[1,2-d]pyrimidine Drug Info [529077]
2-phenyl-9H-indeno[2,1-d]pyrimidine Drug Info [529077]
2-[7-(Benzyloxy)-2-oxo-2H-chromen-4-yl]acetamide Drug Info [530434]
3,4-Benzo-7-(beta-bromoallyloxy)-8-methylcoumarin Drug Info [529735]
3,4-Benzo-7-acetonyloxy-8-methoxycoumarin Drug Info [529735]
3,4-Benzo-7-acetonyloxy-8-methylcoumarin Drug Info [529735]
3,4-Dichloro-N-(2-methyl-1H-indol-5-yl)benzamide Drug Info [531067]
3-aminoacetamido-4'-methylfuro[3,2-g]coumarin Drug Info [528005]
3-benzyl-N-(2-morpholinoethyl)quinoxalin-2-amine Drug Info [527928]
3-Chloro-N-(2-methyl-1H-indol-5-yl)benzamide Drug Info [531067]
3-methyl-2(1H)-thioxo-4(3H)-quinazolinone Drug Info [529873]
4,8-Dimethyl-7-(2'-oxocyclohexyloxy)coumarin Drug Info [529735]
4,9-Dihydro-3H-beta-carboline Drug Info [526994]
4-(2-oxo-2H-chromene-3-carboxamido)benzoic acid Drug Info [530001]
4-(Aminomethyl)-7-(benzyloxy)-2H-chromen-2-one Drug Info [530434]
4-Chloro-N-(2-morpholinoethyl)nicotinamide Drug Info [530675]
4-Chloro-N-(3-morpholinopropyl)nicotinamide Drug Info [530675]
4-methyl-2H-benzofuro[3,2-g]chromen-2-one Drug Info [528005]
4-methyl-7-(2-oxocyclopentyloxy)-2H-chromen-2-one Drug Info [529735]
5,6-Dichloro-N-(2-morpholinoethyl)nicotinamide Drug Info [530675]
5,6-Dichloro-N-(3-morpholinopropyl)nicotinamide Drug Info [530675]
5-Azidomethyl-3-pyrrol-1-yl-oxazolidin-2-one Drug Info [526287]
5-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526993]
5-Bromo-4,9-dihydro-3H-beta-carboline Drug Info [526993]
5-Hydroxymethyl-3-pyrrol-1-yl-oxazolidin-2-one Drug Info [526287]
5-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526993]
5-Methoxy-4,9-dihydro-3H-beta-carboline Drug Info [526993]
5-Methoxymethyl-3-pyrrol-1-yl-oxazolidin-2-one Drug Info [526287]
6,11-dihydro-5H-benzo[a]carbazole Drug Info [529077]
6-amino-9-methoxy-7H-furo[3,2-g]chromen-7-one Drug Info [529735]
6-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526993]
6-Bromo-4,9-dihydro-3H-beta-carboline Drug Info [526993]
6-Chloro-N-(2-morpholinoethyl)nicotinamide Drug Info [530675]
6-Chloro-N-(3-morpholinopropyl)nicotinamide Drug Info [530675]
6-Fluoro-N-(2-morpholinoethyl)nicotinamide Drug Info [530675]
6-Hydroxy-N-(2-morpholinoethyl)nicotinamide Drug Info [530675]
6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526994]
6-Methoxy-4,9-dihydro-3H-beta-carboline Drug Info [526994]
7-(3-chlorobenzyloxy)-4-carboxaldehyde-coumarin Drug Info [529080]
7-Acetonyloxy-3,4-cyclohexene-8-methylcoumarin Drug Info [529735]
7-Acetonyloxy-3,4-cyclopentene-8-methylcoumarin Drug Info [529735]
7-acetonyloxy-3-acetylamino-8-methoxycoumarin Drug Info [528005]
7-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526993]
7-Bromo-4,9-dihydro-3H-beta-carboline Drug Info [526993]
7-METHOXY-1-METHYL-9H-BETA-CARBOLINE Drug Info [551374]
7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526918]
7-Methoxy-9H-beta-carboline Drug Info [526993]
8-(3-Bromobenzyloxy)caffeine Drug Info [530647]
8-(3-Chlorobenzyloxy)caffeine Drug Info [530647]
8-(3-Fluorobenzyloxy)caffeine Drug Info [530647]
8-(3-Methoxybenzyloxy)caffeine Drug Info [530647]
8-(3-Methylbenzyloxy)caffeine Drug Info [530647]
8-Benzyloxycaffeine Drug Info [530647]
8-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526993]
8-Bromo-4,9-dihydro-3H-beta-carboline Drug Info [526993]
8-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526993]
8-Methoxy-4,9-dihydro-3H-beta-carboline Drug Info [526993]
8-[(3-Trifluoromethyl)benzyloxy]caffeine Drug Info [530647]
9-(3-aminopropoxy)-7H-furo[3,2-g]chromen-7-one Drug Info [528005]
9-Methyl-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526993]
Befloxatone Drug Info [534110]
Beta-methoxyamphetamine Drug Info [529986]
BW-1370U87 Drug Info [533985], [551871]
C-(1H-Indol-3-yl)-methylamine Drug Info [526993]
CGS-19281A Drug Info [526994]
CHF-3381 Drug Info [536374]
Cis-(+/-)-2-Fluoro-1,2-diphenylcyclopropylamine Drug Info [529607]
Cis-2-phenylcyclopropylamine Drug Info [529607]
Clorgyline Drug Info [537290]
CS-722 Drug Info [526826]
CX157 Drug Info [530498]
DECYL(DIMETHYL)PHOSPHINE OXIDE Drug Info [551374]
ESUPRONE Drug Info [534393], [551871]
Ethyl 4-(2-oxo-2H-chromene-3-carboxamido)benzoate Drug Info [530001]
FA-70 Drug Info [543637]
Flavin-Adenine Dinucleotide Drug Info [551393]
HARMINE Drug Info [530562]
HYDRAZINECARBOXAMIDE Drug Info [527283]
IPRONIAZIDE Drug Info [530675]
Isocarboxazid Drug Info [537841]
Isopsoralen Drug Info [535106]
Ladostigil Drug Info [531772]
Moclobemide Drug Info [535620]
N'-(2-phenylallyl)hydrazine hydrochloride Drug Info [528105]
N-((1H-indol-2-yl)methyl)(phenyl)methanamine Drug Info [529768]
N-((1H-indol-2-yl)methyl)-2-phenylethanamine Drug Info [529768]
N-(1-Methyl-1H-indol-2-ylmethyl)-N-phenylamine Drug Info [529768]
N-(1H-Indol-2-ylmethyl)-N-(4-phenylbutyl)amine Drug Info [529768]
N-(1H-Indol-2-ylmethyl)-N-methyl-N-phenylamine Drug Info [529768]
N-(1H-Indol-2-ylmethyl)-N-phenylamine Drug Info [529768]
N-(2-benzyl),N-(1-methylpyrrol-2-ylmethyl)amine Drug Info [528641]
N-(2-Methyl-1H-indol-5-yl)cyclohexanecarboxamide Drug Info [531067]
N-(2-phenylethyl),N-(pyrrol-2-ylmethyl)amine Drug Info [528641]
N-(2-Phenylethyl)-1H-indole-2-carboxamide Drug Info [529768]
N-(3-Phenylpropyl)-1H-indole-2-carboxamide Drug Info [529768]
N-(3-phenylpropyl)-1H-pyrrole-2-carboxamide Drug Info [528641]
N-(4-Ethylphenyl)-2-oxo-2H-chromene-3-carboxamide Drug Info [530001]
N-(4-Phenylbutyl)-1H-indole-2-carboxamide Drug Info [529768]
N-(4-phenylbutyl)-1H-pyrrole-2-carboxamide Drug Info [528641]
N-(benzyl),N-(pyrrol-2-ylmethyl)amine Drug Info [528641]
N-(propargyl),N-(pyrrol-2-ylmethyl)amine Drug Info [528641]
N-2-phenylethyl-1H-pyrrole-2-carboxamide Drug Info [528641]
N-Benzyl,N-methyl-1H-indole-2-carboxamide Drug Info [529768]
N-benzyl,N-methyl-1H-pyrrole-2-carboxamide Drug Info [528641]
N-Benzyl-(6-butoxy-2-naphthyl)-2-aminopropane Drug Info [529986]
N-Benzyl-(6-methoxy-2-naphthyl)-2-aminopropane Drug Info [529986]
N-Benzyl-1H-indole-2-carboxamide Drug Info [529768]
N-benzyl-1H-pyrrole-2-carboxamide Drug Info [528641]
N-Benzyl-N-(1H-indol-2-ylmethyl)-N-methylamine Drug Info [529768]
N-methyl,N-(benzyl),N-(pyrrol-2-ylmethyl)amine Drug Info [528641]
N-methyl,N-(propargyl),N-(pyrrol-2-ylmethyl)amine Drug Info [528641]
N-Methyl,N-phenyl-1H-indole-2-carboxamide Drug Info [529768]
N-methyl-N-(prop-2-ynyl)-1H-pyrrole-2-carboxamide Drug Info [528641]
N-Phenyl-1-methyl-1H-indole-2-carboxamide Drug Info [529768]
N-Phenyl-1H-indole-2-carboxamide Drug Info [529768]
N-phenyl-1H-pyrrole-2-carboxamide Drug Info [528641]
N-propargyl-1H-pyrrole-2-carboxamide Drug Info [528641]
N2-[4-(benzyloxy)benzyl]glycinamide Drug Info [529025]
N2-{4-[(3-fluorobenzyl)oxy]benzyl}glycinamide Drug Info [529025]
N2-{4-[(4-chlorobenzyl)oxy]benzyl}glycinamide Drug Info [529025]
NSC-656158 Drug Info [530662]
Phenyl 4-(4,5-dihydro-1H-imidazol-2-yl)benzoate Drug Info [529853]
PIPERINE Drug Info [530562]
PNU-22394 Drug Info [526993]
Psoralen Drug Info [535106]
RS-8359 Drug Info [536146]
TOLOXATONE Drug Info [528273]
TRACIZOLINE Drug Info [526918]
Trans-(+/-)-2-Fluoro-1,2-diphenylcyclopropylamine Drug Info [529607]
Trans-2-(4-chlorophenyl)-2-fluorocyclopropanamine Drug Info [529607]
Trans-2-fluoro-2-(4-fluorophenyl)cyclopropanamine Drug Info [529607]
Trans-2-fluoro-2-p-tolylcyclopropanamine Drug Info [529607]
Trans-2-fluoro-2-phenylcyclopropylamin Drug Info [529607]
Tranylcypromine Drug Info [536265], [537141]
TRYPTAMINE Drug Info [526993]
TRYPTOLINE Drug Info [526918]
Antagonist 4-Methoxyamphetamine Drug Info [551380]
MMDA Drug Info [551393]
Modulator Bifemelane Drug Info [533445]
Brofaromine Drug Info [533333]
Desoxypeganine Drug Info [529540]
E-2011 Drug Info [534616]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
BioCyc Pathway Superpathway of tryptophan utilization
Dopamine degradation
Putrescine degradation III
Noradrenaline and adrenaline degradation
Serotonin degradation
Superpathway of melatonin degradation
Melatonin degradation II
KEGG Pathway Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
NetPath Pathway IL4 Signaling Pathway
PANTHER Pathway Adrenaline and noradrenaline biosynthesis
5-Hydroxytryptamine degredation
Dopamine receptor mediated signaling pathway
PathWhiz Pathway Histidine Metabolism
Tyrosine Metabolism
Glycine and Serine Metabolism
Reactome Norepinephrine Neurotransmitter Release Cycle
WikiPathways SIDS Susceptibility Pathways
Biogenic Amine Synthesis
Oxidative Stress
Dopamine metabolism
Phase 1 - Functionalization of compounds
Neurotransmitter Release Cycle
Neurotransmitter Clearance In The Synaptic Cleft
Serotonin Transporter Activity
References
Ref 521730ClinicalTrials.gov (NCT00227136) Effect of Oral 5-HTP Intake on Urinary 5-HIAA Excretion. U.S. National Institutes of Health.
Ref 523264ClinicalTrials.gov (NCT01246908) Efficacy, Safety and Tolerability of CX157 in Treatment Resistant Depression. U.S. National Institutes of Health.
Ref 523529ClinicalTrials.gov (NCT01383694) Effect Of Piperine In Patients With Oropharyngeal Dysphagia. U.S. National Institutes of Health.
Ref 524054ClinicalTrials.gov (NCT01686594) PUVA Maintenance Therapy in Mycosis Fungoides. U.S. National Institutes of Health.
Ref 529017Indantadol, a novel NMDA antagonist and nonselective MAO inhibitor for the potential treatment of neuropathic pain. IDrugs. 2007 Sep;10(9):636-44.
Ref 529540Phase I clinical trial with desoxypeganine, a new cholinesterase and selective MAO-A inhibitor: tolerance and pharmacokinetics study of escalating single oral doses. Methods Find Exp Clin Pharmacol. 2008 Mar;30(2):141-7.
Ref 531772Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94.
Ref 5334454-(O-benzylphenoxy)-N-methylbutylamine (bifemelane) and other 4-(O-benzylphenoxy)-N-methylalkylamines as new inhibitors of type A and B monoamine oxidase. J Neurochem. 1988 Jan;50(1):243-7.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 536374Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
Ref 537290Further investigation into the mechanism of tachykinin NK(2) receptor-triggered serotonin release from guinea-pig proximal colon. J Pharmacol Sci. 2009 May;110(1):122-6. Epub 2009 May 8.
Ref 538453FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011961.
Ref 538764(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 125).
Ref 539613(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2489).
Ref 541746(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6636).
Ref 541747(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6637).
Ref 542218(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7204).
Ref 542451(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7428).
Ref 544693Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000633)
Ref 544708Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000689)
Ref 544889Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001426)
Ref 545298Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002739)
Ref 545345Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002928)
Ref 545373Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003060)
Ref 545896Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005281)
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 525733Bioorg Med Chem Lett. 2000 Mar 20;10(6):605-7.Probes for imidazoline binding sites: synthesis and evaluation of a selective, irreversible I2 ligand.
Ref 526287J Med Chem. 2002 Mar 14;45(6):1180-3.3-(1H-Pyrrol-1-yl)-2-oxazolidinones as reversible, highly potent, and selective inhibitors of monoamine oxidase type A.
Ref 526455J Med Chem. 2002 Nov 21;45(24):5260-79.Novel dual inhibitors of AChE and MAO derived from hydroxy aminoindan and phenethylamine as potential treatment for Alzheimer's disease.
Ref 526826Mechanisms of spinal reflex depressant effects of CS-722, a newly synthesized centrally acting muscle relaxant, in spinal rats. Neuropharmacology. 1992 Sep;31(9):949-54.
Ref 526918Bioorg Med Chem Lett. 2004 Jan 19;14(2):527-9.Binding of an imidazopyridoindole at imidazoline I2 receptors.
Ref 526993Bioorg Med Chem Lett. 2004 Feb 23;14(4):999-1002.Binding of beta-carbolines at imidazoline I2 receptors: a structure-affinity investigation.
Ref 526994Bioorg Med Chem Lett. 2004 Feb 23;14(4):1003-5.Pyrazino[1,2-a]indoles as novel high-affinity and selective imidazoline I(2) receptor ligands.
Ref 527283J Med Chem. 2004 Nov 18;47(24):5860-71.Fluorinated phenylcyclopropylamines. 2. Effects of aromatic ring substitution and of absolute configuration on inhibition of microbial tyramine oxidase.
Ref 527928Bioorg Med Chem Lett. 2006 Mar 15;16(6):1753-6. Epub 2005 Dec 13.Synthesis of 3-benzyl-2-substituted quinoxalines as novel monoamine oxidase A inhibitors.
Ref 528005J Med Chem. 2006 Feb 9;49(3):1149-56.A QSAR model for in silico screening of MAO-A inhibitors. Prediction, synthesis, and biological assay of novel coumarins.
Ref 528105J Med Chem. 2006 Apr 6;49(7):2166-73.Design, synthesis, and biological evaluation of semicarbazide-sensitive amine oxidase (SSAO) inhibitors with anti-inflammatory activity.
Ref 528273J Nat Prod. 2006 Jun;69(6):945-9.Quercetin as the active principle of Hypericum hircinum exerts a selective inhibitory activity against MAO-A: extraction, biological analysis, and computational study.
Ref 528409J Med Chem. 2006 Sep 7;49(18):5578-86.3-[5-(4,5-dihydro-1H-imidazol-2-yl)-furan-2-yl]phenylamine (Amifuraline), a promising reversible and selective peripheral MAO-A inhibitor.
Ref 528641J Med Chem. 2007 Mar 8;50(5):922-31. Epub 2007 Jan 26.New pyrrole inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A and MAO-B selectivity.
Ref 528855Bioorg Med Chem. 2007 Aug 1;15(15):5198-206. Epub 2007 May 22.Human and rat monoamine oxidase-A are differentially inhibited by (S)-4-alkylthioamphetamine derivatives: insights from molecular modeling studies.
Ref 529025J Med Chem. 2007 Oct 4;50(20):4909-16. Epub 2007 Sep 7.Solid-phase synthesis and insights into structure-activity relationships of safinamide analogues as potent and selective inhibitors of type B monoamine oxidase.
Ref 529077J Med Chem. 2007 Nov 1;50(22):5364-71. Epub 2007 Oct 2.Synthesis and monoamine oxidase inhibitory activity of new pyridazine-, pyrimidine- and 1,2,4-triazine-containing tricyclic derivatives.
Ref 529080J Med Chem. 2007 Nov 15;50(23):5848-52. Epub 2007 Oct 4.Structures of human monoamine oxidase B complexes with selective noncovalent inhibitors: safinamide and coumarin analogs.
Ref 529540Phase I clinical trial with desoxypeganine, a new cholinesterase and selective MAO-A inhibitor: tolerance and pharmacokinetics study of escalating single oral doses. Methods Find Exp Clin Pharmacol. 2008 Mar;30(2):141-7.
Ref 529607Bioorg Med Chem. 2008 Aug 1;16(15):7148-66. Epub 2008 Jun 28.Fluorinated phenylcyclopropylamines. Part 5: Effects of electron-withdrawing or -donating aryl substituents on the inhibition of monoamine oxidases A and B by 2-aryl-2-fluoro-cyclopropylamines.
Ref 529735J Med Chem. 2008 Nov 13;51(21):6740-51. Epub 2008 Oct 4.Quantitative structure-activity relationship and complex network approach to monoamine oxidase A and B inhibitors.
Ref 529768Bioorg Med Chem. 2008 Nov 15;16(22):9729-40. Epub 2008 Oct 2.Synthesis, structure-activity relationships and molecular modeling studies of new indole inhibitors of monoamine oxidases A and B.
Ref 529853Bioorg Med Chem Lett. 2009 Jan 15;19(2):546-9. Epub 2008 Mar 6.Ultrasound promoted synthesis of 2-imidazolines in water: a greener approach toward monoamine oxidase inhibitors.
Ref 529873Bioorg Med Chem. 2009 Jan 15;17(2):675-89. Epub 2008 Dec 3.New pyrazoline bearing 4(3H)-quinazolinone inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A and MAO-B selectivity.
Ref 529986Bioorg Med Chem. 2009 Mar 15;17(6):2452-60. Epub 2009 Feb 8.Naphthylisopropylamine and N-benzylamphetamine derivatives as monoamine oxidase inhibitors.
Ref 530001J Med Chem. 2009 Apr 9;52(7):1935-42.Synthesis, molecular modeling, and selective inhibitory activity against human monoamine oxidases of 3-carboxamido-7-substituted coumarins.
Ref 530056Bioorg Med Chem Lett. 2009 May 1;19(9):2509-13. Epub 2009 Mar 14.Inhibition of monoamine oxidase by (E)-styrylisatin analogues.
Ref 530434J Med Chem. 2009 Nov 12;52(21):6685-706.Discovery of a novel class of potent coumarin monoamine oxidase B inhibitors: development and biopharmacological profiling of 7-[(3-chlorobenzyl)oxy]-4-[(methylamino)methyl]-2H-chromen-2-one methanesulfonate (NW-1772) as a highly potent, selective, reversible, and orally active monoamine oxidase B inhibitor.
Ref 530498Reversible inhibitors of monoamine oxidase-A (RIMAs): robust, reversible inhibition of human brain MAO-A by CX157. Neuropsychopharmacology. 2010 Feb;35(3):623-31.
Ref 530562Bioorg Med Chem Lett. 2010 Jan 15;20(2):537-40. Epub 2009 Nov 26.Proposed structural basis of interaction of piperine and related compounds with monoamine oxidases.
Ref 530647Bioorg Med Chem. 2010 Feb;18(3):1018-28. Epub 2010 Jan 6.Inhibition of monoamine oxidase by 8-benzyloxycaffeine analogues.
Ref 530662J Med Chem. 2010 Feb 25;53(4):1616-26.Synthesis and preclinical evaluations of 2-(2-fluorophenyl)-6,7-methylenedioxyquinolin-4-one monosodium phosphate (CHM-1-P-Na) as a potent antitumor agent.
Ref 530675Bioorg Med Chem. 2010 Feb 15;18(4):1659-64. Epub 2010 Jan 4.Design of novel nicotinamides as potent and selective monoamine oxidase a inhibitors.
Ref 530683Bioorg Med Chem. 2010 Feb 15;18(4):1388-95. Epub 2010 Jan 15.2-Arylthiomorpholine derivatives as potent and selective monoamine oxidase B inhibitors.
Ref 531067Eur J Med Chem. 2010 Oct;45(10):4458-66. Epub 2010 Jul 31.Inhibition of monoamine oxidase by indole and benzofuran derivatives.
Ref 531772Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94.
Ref 533333Preclinical profiles of the novel reversible MAO-A inhibitors, moclobemide and brofaromine, in comparison with irreversible MAO inhibitors. J Neural Transm Suppl. 1989;28:5-20.
Ref 5334454-(O-benzylphenoxy)-N-methylbutylamine (bifemelane) and other 4-(O-benzylphenoxy)-N-methylalkylamines as new inhibitors of type A and B monoamine oxidase. J Neurochem. 1988 Jan;50(1):243-7.
Ref 533985Preclinical and early clinical studies with BW 1370U87, a reversible competitive monoamine oxidase-A inhibitor. Clin Neuropharmacol. 1993;16 Suppl 2:S25-33.
Ref 534110Befloxatone, a new reversible and selective monoamine oxidase-A inhibitor. II. Pharmacological profile. J Pharmacol Exp Ther. 1996 Apr;277(1):265-77.
Ref 534393MAO-A inhibition in brain after dosing with esuprone, moclobemide and placebo in healthy volunteers: in vivo studies with positron emission tomography. Eur J Clin Pharmacol. 1997;52(2):121-8.
Ref 534616Species differences and mechanism of the epimerization of a new MAO-A inhibitor. Xenobiotica. 1998 Mar;28(3):269-80.
Ref 535106Inhibition of rat brain monoamine oxidase activities by psoralen and isopsoralen: implications for the treatment of affective disorders. Pharmacol Toxicol. 2001 Feb;88(2):75-80.
Ref 535620Efficacy of citalopram and moclobemide in patients with social phobia: some preliminary findings. Hum Psychopharmacol. 2002 Dec;17(8):401-5.
Ref 536146Stereospecific oxidation of the (S)-enantiomer of RS-8359, a selective and reversible monoamine oxidase A (MAO-A) inhibitor, by aldehyde oxidase. Xenobiotica. 2005 Jun;35(6):561-73.
Ref 536265Tranylcypromine: new perspectives on an "old" drug. Eur Arch Psychiatry Clin Neurosci. 2006 Aug;256(5):268-73.
Ref 536374Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
Ref 537141Tramadol and another atypical opioid meperidine have exaggerated serotonin syndrome behavioural effects, but decreased analgesic effects, in genetically deficient serotonin transporter (SERT) mice. Int J Neuropsychopharmacol. 2009 Mar 11:1-11.
Ref 537290Further investigation into the mechanism of tachykinin NK(2) receptor-triggered serotonin release from guinea-pig proximal colon. J Pharmacol Sci. 2009 May;110(1):122-6. Epub 2009 May 8.
Ref 537841MAOIs in the contemporary treatment of depression. Neuropsychopharmacology. 1995 May;12(3):185-219.
Ref 543637(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2489).
Ref 551222Synthesis, semipreparative HPLC separation, biological evaluation, and 3D-QSAR of hydrazothiazole derivatives as human monoamine oxidase B inhibitors. Bioorg Med Chem. 2010 Jul 15;18(14):5063-70. doi: 10.1016/j.bmc.2010.05.070. Epub 2010 Jun 1.
Ref 551374The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
Ref 551380Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77.
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.