Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T98062
|
||||
Former ID |
TTDC00099
|
||||
Target Name |
Glycogen phosphorylase, muscle form
|
||||
Gene Name |
PYGM
|
||||
Synonyms |
Glycogen phosphorylase b; Muscle glycogen phosphorylase; PYGM
|
||||
Target Type |
Discontinued
|
||||
Disease | Type 2 diabetes [ICD9: 250; ICD10: E11] | ||||
Function |
Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.
|
||||
BioChemical Class |
Hexosyltransferase
|
||||
Target Validation |
T98062
|
||||
UniProt ID | |||||
EC Number |
EC 2.4.1.1
|
||||
Sequence |
MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTV
RDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDM EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKISGGWQMEEA DDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVN TMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV VAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRILVDLERM DWDKAWDVTVRTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFP GDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKF QNKTNGITPRRWLVLCNPGLAEVIAERIGEDFISDLDQLRKLLSFVDDEAFIRDVAKVKQ ENKLKFAAYLEREYKVHINPNSLFDIQVKRIHEYKRQLLNCLHVITLYNRIKREPNKFFV PRTVMIGGKAAPGYHMAKMIIRLVTAIGDVVNHDPAVGDRLRVIFLENYRVSLAEKVIPA ADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVD KLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYED YIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDE AI |
||||
Drugs and Mode of Action | |||||
Inhibitor | 1-D-glucopyranosyl cytosine | Drug Info | [530881] | ||
1-D-glucopyranosyl uracil | Drug Info | [530881] | |||
1-Deoxy-1-Methoxycarbamido-Beta-D-Glucopyranose | Drug Info | [551393] | |||
1-N-Acetyl-Beta-D-Glucosamine | Drug Info | [551393] | |||
2-Deoxy-Glucose-6-Phosphate | Drug Info | [551393] | |||
2-Hydroxyiminoolean-12-en-28-oic acid | Drug Info | [530285] | |||
2-Hydroxyiminours-12-en-28-oic acid | Drug Info | [530285] | |||
2-isooleanolic acid | Drug Info | [530285] | |||
2-isoursolic acid | Drug Info | [530285] | |||
2-Oxoolean-12-en-28-oic acid | Drug Info | [530285] | |||
23-hydroxybetulinic acid | Drug Info | [529507] | |||
2alpha-Hydroxyolean-12-en-28-oic acid | Drug Info | [530285] | |||
2alpha-Hydroxyurs-12-en-28-oic acid | Drug Info | [530285] | |||
2beta,3alpha-dihydroxyolean-12-en-28-oic acid | Drug Info | [529742] | |||
2beta,3alpha-dihydroxyurs-12-en-28-oic acid | Drug Info | [529742] | |||
3alpha-Hydroxyurs-12-en-28-oic Acid | Drug Info | [529507] | |||
4-{2-[(3-Nitrobenzoyl)Amino]Phenoxy}Phthalic Acid | Drug Info | [551374] | |||
Acurea | Drug Info | [535400] | |||
Alpha-D-Glucopyranosyl-2-Carboxylic Acid Amide | Drug Info | [551393] | |||
Alpha-D-Glucose-1-Phosphate | Drug Info | [551393] | |||
Alpha-D-Glucose-6-Phosphate | Drug Info | [551393] | |||
ASIATIC ACID | Drug Info | [529507] | |||
Benzyl 2-hydroxyiminoolean-12-en-28-oate | Drug Info | [530285] | |||
Beta-D-Glucopyranose Spirohydantoin | Drug Info | [551393] | |||
Beta-D-Glucose | Drug Info | [551393] | |||
BETULIN | Drug Info | [529507] | |||
Bzurea | Drug Info | [535400] | |||
C-(1-Azido-Alpha-D-Glucopyranosyl) Formamide | Drug Info | [551391] | |||
C-(1-Hydrogyl-Beta-D-Glucopyranosyl) Formamide | Drug Info | [551393] | |||
Ethyl 2beta-hydroxyolean-12-en-28-oate | Drug Info | [530285] | |||
Fluoro-Phosphite Ion | Drug Info | [551393] | |||
Heptulose-2-Phosphate | Drug Info | [551393] | |||
Indirubin-5-Sulphonate | Drug Info | [551393] | |||
Inosinic Acid | Drug Info | [551393] | |||
JTT-651 | Drug Info | [548601] | |||
N'-Pyridoxyl-Lysine-5'-Monophosphate | Drug Info | [551393] | |||
N-Acetyl-N'-Beta-D-Glucopyranosyl Urea | Drug Info | [551391] | |||
N-Benzoyl-N'-Beta-D-Glucopyranosyl Urea | Drug Info | [551393] | |||
N-Butyl 2beta-hydroxyolean-12-en-28-oate | Drug Info | [530285] | |||
Nojirimycine Tetrazole | Drug Info | [551374] | |||
OLEANOLIC_ACID | Drug Info | [529507] | |||
Oleanonic acid | Drug Info | [529507] | |||
Phosphonoserine | Drug Info | [551393] | |||
URSOLIC ACID | Drug Info | [530285] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | Glycogenolysis | ||||
KEGG Pathway | Starch and sucrose metabolism | ||||
Metabolic pathways | |||||
Insulin signaling pathway | |||||
Glucagon signaling pathway | |||||
PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
WikiPathways | Glycogen Metabolism | ||||
Metabolism of carbohydrates | |||||
References | |||||
Ref 529507 | J Med Chem. 2008 Jun 26;51(12):3540-54. Epub 2008 Jun 3.Naturally occurring pentacyclic triterpenes as inhibitors of glycogen phosphorylase: synthesis, structure-activity relationships, and X-ray crystallographic studies. | ||||
Ref 529742 | J Nat Prod. 2008 Nov;71(11):1877-80. Epub 2008 Oct 11.Practical synthesis of bredemolic Acid, a natural inhibitor of glycogen phosphorylase. | ||||
Ref 530285 | J Nat Prod. 2009 Aug;72(8):1414-8.Synthesis of 3-deoxypentacyclic triterpene derivatives as inhibitors of glycogen phosphorylase. | ||||
Ref 530881 | Bioorg Med Chem. 2010 May 15;18(10):3413-25. Epub 2010 Apr 7.1-(3-Deoxy-3-fluoro-beta-d-glucopyranosyl) pyrimidine derivatives as inhibitors of glycogen phosphorylase b: Kinetic, crystallographic and modelling studies. | ||||
Ref 535400 | Binding of N-acetyl-N '-beta-D-glucopyranosyl urea and N-benzoyl-N '-beta-D-glucopyranosyl urea to glycogen phosphorylase b: kinetic and crystallographic studies. Eur J Biochem. 2002 Mar;269(6):1684-96. | ||||
Ref 548601 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026877) |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.