Target Information

Target General Infomation
Target ID
T59631
Former ID
TTDNC00489
Target Name
PD-1
Gene Name
PDCD1
Synonyms
CD279; Programmed cell death protein 1; Protein PD1; hPD1; PDCD1
Target Type
Successful
Disease Hematological malignancies [ICD9: 200-209; ICD10: C81-C86]
Melanoma [ICD9: 172; ICD10: C43]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Function
Inhibitory cell surface receptor involved in the regulation of T-cell function during immunity and tolerance. Upon ligand binding, inhibits T-cell effector functions in an antigen- specific manner. Possible cell death inducer, in association with other factors.
BioChemical Class
Immunoglobulin
UniProt ID
Q15116
Sequence
MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS
ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT
YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS
LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP
CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL
Drugs and Mode of Action
Drug(s) MK-3475 Drug Info Approved Melanoma [533123], [542518]
Nivolumab Drug Info Approved B-RAF mutation positive metastatic melanoma [542358], [551486]
Nivolumab Drug Info Approved Advanced non-small cell lung cancer [556264]
AMP-224 Drug Info Phase 1 Solid tumours [523471]
GSK2661380 Drug Info Phase 1 Solid tumours [523471]
MEDI0680 Drug Info Phase 1 Solid tumours [544457]
Modulator AMP-224 Drug Info [550474]
Nivolumab Drug Info [533123]
Inhibitor GSK2661380 Drug Info [543703]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cell adhesion molecules (CAMs)
T cell receptor signaling pathway
Reactome PD-1 signaling
WikiPathways T-Cell Receptor and Co-stimulatory Signaling
Costimulation by the CD28 family
References
Ref 523471ClinicalTrials.gov (NCT01352884) Study to Assess the Safety, Tolerability, and Pharmacokinetics of AMP-224 in Patients With Advanced Cancer. U.S. National Institutes of Health.
Ref 5331232014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81.
Ref 542358(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7335).
Ref 542518(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7499).
Ref 544457A Phase Ib/II open-label study to evaluate the safety and efficacy of MEDI-551 in combination with immunomodulating therapy in patients with relapsed or refractory aggressive B cell lymphomas. J Immunother Cancer. 2014; 2(Suppl 3): P73.
Ref 551486Nivolumab, a Novel Anti??D-1 Monoclonal Antibody for the Treatment of Solid and Hematologic Malignancies (Personalized Medicine in Oncology). Emma Thornton. Anti-PD-1 Therapy. June 2014
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
Ref 5331232014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81.
Ref 543703(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2760).
Ref 544457A Phase Ib/II open-label study to evaluate the safety and efficacy of MEDI-551 in combination with immunomodulating therapy in patients with relapsed or refractory aggressive B cell lymphomas. J Immunother Cancer. 2014; 2(Suppl 3): P73.
Ref 550474National Cancer Institute Drug Dictionary (drug id 700595).

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.