Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T86364
|
||||
Former ID |
TTDC00204
|
||||
Target Name |
Vasoactive intestinal polypeptide receptor 1
|
||||
Gene Name |
VIPR1
|
||||
Synonyms |
PACAP type II receptor; PACAP-R-2; Pituitary adenylate cyclase activating polypeptide type II receptor; VIP-R-1; VPAC-1; VPAC1; Vasoactive intestinal peptide receptor 1; Vasoactive intestinal peptide/pituitary adenylate cyclase activating polypeptide receptor-1; VIPR1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Chronic obstructive pulmonary disease; Pulmonary arterial hypertension [ICD9: 401, 416.0, 490-492, 494-496; ICD10: I10-I16, I27.0, I27.2, J40-J44, J47] | ||||
Respiratory disease [ICD10: J00-J99] | |||||
Function |
This is a receptor for vip. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The affinity is vip = pacap-27 > pacap-38.
|
||||
BioChemical Class |
GPCR secretin
|
||||
Target Validation |
T86364
|
||||
UniProt ID | |||||
Sequence |
MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENET
IGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPI ACGLDDKAASLDEQQTMFYGSVKTGYTIGYGLSLATLLVATAILSLFRKLHCTRNYIHMH LFISFILRAAAVFIKDLALFDSGESDQCSEGSVGCKAAMVFFQYCVMANFFWLLVEGLYL YTLLAVSFFSERKYFWGYILIGWGVPSTFTMVWTIARIHFEDYGCWDTINSSLWWIIKGP ILTSILVNFILFICIIRILLQKLRPPDIRKSDSSPYSRLARSTLLLIPLFGVHYIMFAFF PDNFKPEVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVLGWNPKYRH PSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLV |
||||
Structure |
1OF2; 1OGT; 3B3I; 3B6S; 3DTX; 3HCV
|
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
NetPath Pathway | TCR Signaling Pathway | ||||
Pathway Interaction Database | Glucocorticoid receptor regulatory network | ||||
Reactome | G alpha (s) signalling events | ||||
WikiPathways | SIDS Susceptibility Pathways | ||||
GPCRs, Class B Secretin-like | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
Ref 528390 | A systematic comparison of intracellular cyclic AMP and calcium signalling highlights complexities in human VPAC/PAC receptor pharmacology. Neuropharmacology. 2006 Nov;51(6):1086-98. Epub 2006 Aug 23. | ||||
Ref 529569 | J Med Chem. 2008 Jul 24;51(14):4150-69. Epub 2008 Jun 28.Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. | ||||
Ref 534199 | Stable expression of the recombinant human VIP1 receptor in clonal Chinese hamster ovary cells: pharmacological, functional and molecular properties. Eur J Pharmacol. 1996 Apr 29;302(1-3):207-14. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.