Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T35734
|
||||
Former ID |
TTDR01203
|
||||
Target Name |
Soluble epoxide hydrolase
|
||||
Gene Name |
EPHX2
|
||||
Synonyms |
CEH; Cytosolic epoxide hydrolase; Epoxide Hydrolase; Epoxide hydratase; SEH; EPHX2
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47] | ||||
Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
Function |
This enzyme acts on epoxides (alkene oxides, oxiranes) and arene oxides. plays a role in xenobiotic metabolism by degrading potential toxic epoxides. also determines steady- state levels of physiological mediators.
|
||||
BioChemical Class |
Etherhydrolase
|
||||
Target Validation |
T35734
|
||||
UniProt ID | |||||
EC Number |
EC 3.1.3.76
|
||||
Sequence |
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITL
SQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTA ILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEV VFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESS APPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNT PFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIK WLDSDARNPPVVSKM |
||||
Drugs and Mode of Action | |||||
Inhibitor | 1,3-DIPHENYLUREA | Drug Info | [551374] | ||
1-(1-Adamantyl)-3-(1-propionylpiperidin-4-yl)urea | Drug Info | [531143] | |||
1-(1-Propionylpiperidin-4-yl)-3-m-tolylurea | Drug Info | [531143] | |||
1-(1-Propionylpiperidin-4-yl)-3-o-tolylurea | Drug Info | [531143] | |||
1-(1-Propionylpiperidin-4-yl)-3-p-tolylurea | Drug Info | [531143] | |||
1-(3-(3-morpholinopropoxy)phenyl)-3-phenylurea | Drug Info | [530204] | |||
1-(3-Chloro-phenyl)-3-(4-hydroxy-decyl)-urea | Drug Info | [527552] | |||
1-(3-Chloro-phenyl)-3-cyclohexyl-urea | Drug Info | [527552] | |||
1-(4-(3-morpholinopropoxy)phenyl)-3-phenylurea | Drug Info | [530204] | |||
1-adamantan-1-yl-3-((R)-1-phenyl-ethyl)-urea | Drug Info | [528417] | |||
1-adamantan-1-yl-3-(1-benzyl-piperidin-4-yl)-urea | Drug Info | [528339] | |||
1-adamantan-1-yl-3-(1-butyl-piperidin-4-yl)-urea | Drug Info | [528339] | |||
1-adamantan-1-yl-3-(1-ethyl-piperidin-4-yl)-urea | Drug Info | [528339] | |||
1-adamantan-1-yl-3-(1-propyl-piperidin-4-yl)-urea | Drug Info | [528339] | |||
1-adamantan-1-yl-3-(2-heptyloxyethyl)urea | Drug Info | [529063] | |||
1-Adamantan-1-yl-3-(2-hydroxy-phenyl)-urea | Drug Info | [529961] | |||
1-adamantan-1-yl-3-(2-hydroxyethyl)urea | Drug Info | [529063] | |||
1-Adamantan-1-yl-3-(2-methoxy-phenyl)-urea | Drug Info | [529961] | |||
1-adamantan-1-yl-3-(3-hexyloxypropyl)urea | Drug Info | [529063] | |||
1-Adamantan-1-yl-3-(3-hydroxy-phenyl)-urea | Drug Info | [529961] | |||
1-adamantan-1-yl-3-(3-hydroxypropyl)urea | Drug Info | [529063] | |||
1-Adamantan-1-yl-3-(3-methoxy-phenyl)-urea | Drug Info | [529961] | |||
1-Adamantan-1-yl-3-(4-hydroxy-decyl)-urea | Drug Info | [527552] | |||
1-Adamantan-1-yl-3-(4-hydroxy-phenyl)-urea | Drug Info | [529961] | |||
1-adamantan-1-yl-3-(4-hydroxybutyl)urea | Drug Info | [529063] | |||
1-Adamantan-1-yl-3-(4-methoxy-phenyl)-urea | Drug Info | [529961] | |||
1-adamantan-1-yl-3-(4-pentyloxybutyl)urea | Drug Info | [529063] | |||
1-adamantan-1-yl-3-(4-pentyloxycylclohexyl)urea | Drug Info | [529063] | |||
1-adamantan-1-yl-3-(5-butoxypentyl)urea | Drug Info | [529063] | |||
1-adamantan-1-yl-3-(5-hydroxypentyl)urea | Drug Info | [529063] | |||
1-adamantan-1-yl-3-(6-hydroxyhexyl)urea | Drug Info | [529063] | |||
1-adamantan-1-yl-3-(6-propyloxyhexyl)urea | Drug Info | [529063] | |||
1-Adamantan-1-yl-3-decyl-urea | Drug Info | [527552] | |||
1-Adamantan-1-yl-3-phenyl-urea | Drug Info | [529961] | |||
1-adamantan-1-yl-3-piperidin-4-yl-urea | Drug Info | [528339] | |||
1-adamantan-1-yl-3-piperidin-4-ylmethyl-urea | Drug Info | [528339] | |||
1-adamantan-1-yl-3-[4-(4-fluorophenoxy)butyl]urea | Drug Info | [528938] | |||
1-Cycloheptyl-3-(1-propionylpiperidin-4-yl)urea | Drug Info | [531143] | |||
1-Cyclohexyl-3-(1-propionylpiperidin-4-yl)urea | Drug Info | [531143] | |||
1-Cyclohexyl-3-(4-methoxy-phenyl)-urea | Drug Info | [527552] | |||
1-Cyclohexyl-3-phenethyl-urea | Drug Info | [527552] | |||
1-Cyclohexyl-3-phenyl-urea | Drug Info | [527552] | |||
1-Octyl-3-(1-propionylpiperidin-4-yl)urea | Drug Info | [531143] | |||
1-Phenyl-3-(1-propionylpiperidin-4-yl)urea | Drug Info | [531143] | |||
12-(3-Adamantan-1-yl-ureido)-dodeca noic acid | Drug Info | [530286] | |||
12-(3-n-Hexylureido)dodec-8(Z)-enoic acid | Drug Info | [530294] | |||
12-(3-n-Pentylureidooxy)dodec-8(Z)-enoic acid | Drug Info | [530294] | |||
13-(3-n-Pentylthioureido)tridec-8(Z)-enoic Acid | Drug Info | [530294] | |||
13-(3-n-Pentylureido)tridec-5(Z)-enoic acid | Drug Info | [530294] | |||
13-(3-n-Pentylureido)tridec-8(E)-enoic acid | Drug Info | [530294] | |||
13-(3-n-Pentylureido)tridec-8-ynoic acid | Drug Info | [530294] | |||
13-(3-Pentyluredo)tridec-8(Z)-enoic acid | Drug Info | [530294] | |||
13-(5-n-Pentylfuran-2-yl)tridec-8(Z)-enoic acid | Drug Info | [530294] | |||
13-(N-Isopropylheptanamido)tridec-8(Z)-enoic acid | Drug Info | [530294] | |||
13-(N-Methyl-n-heptnamido)tridec-8(Z)-enoic acid | Drug Info | [530294] | |||
13-(n-Pentylcarbamoyloxy)tridec-8(Z)-enoic acid | Drug Info | [530294] | |||
13-n-Heptanamidotridec-5-ynoic acid | Drug Info | [530294] | |||
13-n-Heptanamidotridec-8(Z)-enoic acid | Drug Info | [530294] | |||
14-(n-Hexylamino)-14-oxotetradec-8(Z)-enoic acid | Drug Info | [530294] | |||
16-(3-Ethylureido)hexadec-11(Z)-enoic acid | Drug Info | [530294] | |||
2-Adamantan-1-yl-N-decyl-acetamide | Drug Info | [527552] | |||
2-Cyclohexyl-N-(4-methoxy-phenyl)-acetamide | Drug Info | [527552] | |||
2-Cyclohexyl-N-phenethyl-acetamide | Drug Info | [527552] | |||
2-Cyclohexyl-N-phenyl-acetamide | Drug Info | [527552] | |||
3-(3-Adamantan-1-yl-ureido)-benzoic acid | Drug Info | [529961] | |||
4,4-Diphenyl-N-(pyridin-3-yl)-butyramide | Drug Info | [530375] | |||
4-(3-Adamantan-1-yl-ureido)-benzoic acid | Drug Info | [529961] | |||
4-(3-cyclohexylureido)butanoic acid | Drug Info | [528366] | |||
4-{[(CYCLOHEXYLAMINO)CARBONYL]AMINO}BUTANOIC ACID | Drug Info | [551374] | |||
6-amino-N-(2,4-dichlorobenzyl)nicotinamide | Drug Info | [530386] | |||
6-amino-N-(3,3-diphenylpropyl)nicotinamide | Drug Info | [530386] | |||
6-{[(CYCLOHEXYLAMINO)CARBONYL]AMINO}HEXANOIC ACID | Drug Info | [551374] | |||
9-(3-n-Pentylureido)non-4(Z)-enoic acid | Drug Info | [530294] | |||
9-(3-n-Pentylureido)non-4-ynoic acid | Drug Info | [530294] | |||
Cis-1-adamantan-1-yl-3-(4-hydroxycyclohexyl)urea | Drug Info | [528938] | |||
Cis-1-adamantan-1-yl-3-(4-methoxycyclohexyl)urea | Drug Info | [528938] | |||
Dodecanoic acid adamantan-1-ylamide | Drug Info | [527552] | |||
EXRD-4605 | Drug Info | [532153] | |||
Methyl 14-(3-n-butylureido)tetradec-8(Z)-enoate | Drug Info | [530294] | |||
Methyl 4-(3-cyclohexylureido)butanoate | Drug Info | [528366] | |||
Methyl 6-(3-cyclohexylureido)hexanoate | Drug Info | [528366] | |||
N,N'-dicyclohexyl-urea | Drug Info | [528938] | |||
N-(1-acetylpiperidin-4-yl)-N'-(adamant-1-yl)urea | Drug Info | [528938] | |||
N-(3,3-Diphenyl-propyl)-2-pyridine-3-ylacetamide | Drug Info | [530375] | |||
N-(3,3-Diphenyl-propyl)-isonicotinamide | Drug Info | [530375] | |||
N-(3,3-diphenyl-propyl)-nicotinamide | Drug Info | [530375] | |||
N-(3-Chloro-phenyl)-2-cyclohexyl-acetamide | Drug Info | [527552] | |||
N-(3-Phenyl-propyl)-nicotinamide | Drug Info | [530375] | |||
N-(4,4-Diphenyl-butyl)-nicotinamide | Drug Info | [530375] | |||
N-(biphenyl-3-yl)benzo[d]isoxazol-3-amine | Drug Info | [530329] | |||
N-(biphenyl-4-yl)benzo[d]isoxazol-3-amine | Drug Info | [530329] | |||
N-(naphthalen-1-yl)benzo[d]isoxazol-3-amine | Drug Info | [530329] | |||
N-(naphthalen-2-yl)benzo[d]isoxazol-3-amine | Drug Info | [530329] | |||
N-adamantyl-N'-cyclohexylurea | Drug Info | [528938] | |||
N-benzyl-6-(3,3,3-trifluoropropoxy)nicotinamide | Drug Info | [530386] | |||
N-Cyclohexyl-2-(4-methoxy-phenyl)-acetamide | Drug Info | [527552] | |||
N-Cyclohexyl-2-phenyl-acetamide | Drug Info | [527552] | |||
N-Cyclohexyl-4-phenyl-butyramide | Drug Info | [527552] | |||
N-Cyclohexyl-N'-(4-Iodophenyl)Urea | Drug Info | [551393] | |||
N-Cyclohexyl-N'-(Propyl)Phenyl Urea | Drug Info | [551374] | |||
N-Cyclohexyl-N'-Decylurea | Drug Info | [551374] | |||
N-[(CYCLOHEXYLAMINO)CARBONYL]GLYCINE | Drug Info | [551374] | |||
N-[3,3-Bis-(4-fluorophenyl)-propyl]-benzamide | Drug Info | [530375] | |||
N-[3,3-Bis-(4-fluorophenyl)-propyl]-nicotinamide | Drug Info | [530375] | |||
SEH inhibitors | Drug Info | [532153] | |||
Trans,trans-1,3-bis-(4-hydroxycyclohexyl)urea | Drug Info | [528938] | |||
[4-(3-Adamantan-1-yl-ureido)-phenyl]-acetic acid | Drug Info | [529961] | |||
Modulator | GSK2256294 | Drug Info | [532153], [532245] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Arachidonic acid metabolism | ||||
Metabolic pathways | |||||
Peroxisome | |||||
PathWhiz Pathway | Arachidonic Acid Metabolism | ||||
WikiPathways | Metapathway biotransformation | ||||
Arachidonate Epoxygenase / Epoxide Hydrolase | |||||
Arachidonic acid metabolism | |||||
References | |||||
Ref 527552 | J Med Chem. 2005 May 19;48(10):3621-9.Optimization of amide-based inhibitors of soluble epoxide hydrolase with improved water solubility. | ||||
Ref 528339 | Bioorg Med Chem Lett. 2006 Oct 1;16(19):5212-6. Epub 2006 Jul 25.Synthesis and SAR of conformationally restricted inhibitors of soluble epoxide hydrolase. | ||||
Ref 528366 | Bioorg Med Chem Lett. 2006 Oct 15;16(20):5439-44.Peptidyl-urea based inhibitors of soluble epoxide hydrolases. | ||||
Ref 528417 | Bioorg Med Chem Lett. 2006 Nov 15;16(22):5773-7. Epub 2006 Sep 1.Solid-phase combinatorial approach for the optimization of soluble epoxide hydrolase inhibitors. | ||||
Ref 528938 | J Med Chem. 2007 Aug 9;50(16):3825-40. Epub 2007 Jul 6.Orally bioavailable potent soluble epoxide hydrolase inhibitors. | ||||
Ref 529063 | J Med Chem. 2007 Oct 18;50(21):5217-26. Epub 2007 Sep 26.1,3-disubstituted ureas functionalized with ether groups are potent inhibitors of the soluble epoxide hydrolase with improved pharmacokineticproperties. | ||||
Ref 529961 | Bioorg Med Chem Lett. 2009 Mar 15;19(6):1784-9. Epub 2009 Jan 27.Salicylate-urea-based soluble epoxide hydrolase inhibitors with high metabolic and chemical stabilities. | ||||
Ref 530204 | Bioorg Med Chem Lett. 2009 Aug 1;19(15):4259-63. Epub 2009 May 30.Unsymmetrical non-adamantyl N,N'-diaryl urea and amide inhibitors of soluble expoxide hydrolase. | ||||
Ref 530286 | J Med Chem. 2009 Aug 27;52(16):5009-12.Discovery of a highly potent, selective, and bioavailable soluble epoxide hydrolase inhibitor with excellent ex vivo target engagement. | ||||
Ref 530294 | J Med Chem. 2009 Aug 27;52(16):5069-75.14,15-Epoxyeicosa-5,8,11-trienoic acid (14,15-EET) surrogates containing epoxide bioisosteres: influence upon vascular relaxation and soluble epoxide hydrolase inhibition. | ||||
Ref 530329 | Bioorg Med Chem Lett. 2009 Oct 1;19(19):5716-21. Epub 2009 Aug 7.A strategy of employing aminoheterocycles as amide mimics to identify novel, potent and bioavailable soluble epoxide hydrolase inhibitors. | ||||
Ref 530375 | J Med Chem. 2009 Oct 8;52(19):5880-95.Structure-based optimization of arylamides as inhibitors of soluble epoxide hydrolase. | ||||
Ref 530386 | Bioorg Med Chem Lett. 2009 Oct 15;19(20):5864-8. Epub 2009 Aug 26.Design and synthesis of substituted nicotinamides as inhibitors of soluble epoxide hydrolase. | ||||
Ref 531143 | J Med Chem. 2010 Oct 14;53(19):7067-75.1-Aryl-3-(1-acylpiperidin-4-yl)urea inhibitors of human and murine soluble epoxide hydrolase: structure-activity relationships, pharmacokinetics, and reduction of inflammatory pain. | ||||
Ref 532153 | Soluble epoxide hydrolase inhibition does not prevent cardiac remodeling and dysfunction after aortic constriction in rats and mice. J Cardiovasc Pharmacol. 2013 Apr;61(4):291-301. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.