Target Information

Target General Infomation
Target ID
T30635
Former ID
TTDR00498
Target Name
Small inducible cytokine B10
Gene Name
CXCL10
Synonyms
10 kDa interferon-gamma induced protein; Gamma-IP10; IP-10; Interferon-gamma induced protein; CXCL10
Target Type
Clinical Trial
Disease Autoimmune diabetes [ICD10: E08-E13]
Crohn's disease [ICD9: 555; ICD10: K50]
Crohn's disease; Ulcerative colitis [ICD9: 555, 556, 556.9; ICD10: K50, K50-K52, K51]
Immune disorder [ICD10: D80-D89]
Function
Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
BioChemical Class
Cytokine: CXC chemokine
UniProt ID
P02778
Sequence
MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV
EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Drugs and Mode of Action
Drug(s) Anti-IP10 Drug Info Phase 2 Crohn's disease; Ulcerative colitis [523682]
BMS-936557 Drug Info Phase 2 Immune disorder [523682]
MDX-1100 Drug Info Phase 2 Crohn's disease [531729]
NI-0801 Drug Info Phase 2 Autoimmune diabetes [523613]
Inhibitor N-Methylleucine Drug Info [551393]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
TNF signaling pathway
Influenza A
NetPath Pathway IL-7 Signaling Pathway
TSLP Signaling Pathway
TNFalpha Signaling Pathway
TWEAK Signaling Pathway
TCR Signaling Pathway
PANTHER Pathway Inflammation mediated by chemokine and cytokine signaling pathway
Pathway Interaction Database CXCR3-mediated signaling events
Reactome Chemokine receptors bind chemokines
G alpha (i) signalling events
WikiPathways Toll-like receptor signaling pathway
Type II interferon signaling (IFNG)
Spinal Cord Injury
GPCR ligand binding
GPCR downstream signaling
Regulation of toll-like receptor signaling pathway
References
Ref 523613ClinicalTrials.gov (NCT01430429) Primary Biliary Cirrhosis: Investigating A New Treatment Option Using NI-0801, an Anti-CXCL10 Monoclonal Antibody. U.S. National Institutes of Health.
Ref 523682ClinicalTrials.gov (NCT01466374) Induction and Maintenance Study of BMS-936557 in Patients With Moderate to Severely Active Crohn's Disease. U.S. National Institutes of Health.
Ref 531729A phase II, randomized, double-blind, placebo-controlled study evaluating the efficacy and safety of MDX-1100, a fully human anti-CXCL10 monoclonal antibody, in combination with methotrexate in patients with rheumatoid arthritis. Arthritis Rheum. 2012 Jun;64(6):1730-9.
Ref 531729A phase II, randomized, double-blind, placebo-controlled study evaluating the efficacy and safety of MDX-1100, a fully human anti-CXCL10 monoclonal antibody, in combination with methotrexate in patients with rheumatoid arthritis. Arthritis Rheum. 2012 Jun;64(6):1730-9.
Ref 532252Anti-IP-10 antibody (BMS-936557) for ulcerative colitis: a phase II randomised study. Gut. 2014 Mar;63(3):442-50.
Ref 548829Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029267)
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.