Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T78890
|
||||
Former ID |
TTDI02330
|
||||
Target Name |
Tissue factor pathway inhibitor
|
||||
Gene Name |
TFPI
|
||||
Synonyms |
EPI; Extrinsic pathway inhibitor; LACI; Lipoprotein-associated coagulation inhibitor; TFPI
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Factor IX deficiency [ICD10: D67] | ||||
Sepsis [ICD9: 995.91; ICD10: A40, A41] | |||||
Function |
Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
|
||||
UniProt ID | |||||
Sequence |
MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADD
GPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQE KPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPN GFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIG KCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIF VKNM |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Complement and coagulation cascades | ||||
NetPath Pathway | IL4 Signaling Pathway | ||||
TGF_beta_Receptor Signaling Pathway | |||||
PANTHER Pathway | Blood coagulation | ||||
Pathway Interaction Database | Syndecan-4-mediated signaling events | ||||
Reactome | Extrinsic Pathway of Fibrin Clot Formation | ||||
WikiPathways | Complement and Coagulation Cascades | ||||
Integrated Breast Cancer Pathway | |||||
Formation of Fibrin Clot (Clotting Cascade) | |||||
References | |||||
Ref 523151 | ClinicalTrials.gov (NCT01191372) First-in-Human and Proof-of-Mechanism Study of ARC19499 Administered to Hemophilia Patients. U.S. National Institutes of Health. | ||||
Ref 526665 | Efficacy and safety of tifacogin (recombinant tissue factor pathway inhibitor) in severe sepsis: a randomized controlled trial. JAMA. 2003 Jul 9;290(2):238-47. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.