Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T16347
|
||||
Former ID |
TTDI01934
|
||||
Target Name |
Protein tyrosine phosphatase-1B
|
||||
Gene Name |
PTPN1
|
||||
Synonyms |
PTP-1B; Tyrosine-protein phosphatase non-receptor type 1; PTPN1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Diabetes [ICD9: 253.5, 588.1; ICD10: E23.2, N25.1] | ||||
Obesity [ICD9: 278; ICD10: E66] | |||||
Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
Function |
Tyrosine-protein phosphatase which acts as a regulator of endoplasmic reticulum unfolded protein response. Mediates dephosphorylation of EIF2AK3/PERK; inactivating the protein kinase activity of EIF2AK3/PERK. May play an important role in CKII- and p60c-src-induced signal transduction cascades. May regulate the EFNA5-EPHA3 signaling pathway which modulates cell reorganization and cell-cell repulsion. May also regulate the hepatocyte growth factor receptor signaling pathway through dephosphorylation of MET.
|
||||
BioChemical Class |
Phosphoric monoester hydrolases
|
||||
UniProt ID | |||||
EC Number |
EC 3.1.3.48
|
||||
Sequence |
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT AGAYLCYRFLFNSNT |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Adherens junction | ||||
Insulin signaling pathway | |||||
NetPath Pathway | FSH Signaling Pathway | ||||
PANTHER Pathway | Cadherin signaling pathway | ||||
Pathway Interaction Database | Insulin Pathway | ||||
Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met) | |||||
Signaling events mediated by PTP1B | |||||
Calcineurin-regulated NFAT-dependent transcription in lymphocytes | |||||
Signaling events mediated by TCPTP | |||||
IGF1 pathway | |||||
EGF receptor (ErbB1) signaling pathway | |||||
Posttranslational regulation of adherens junction stability and dissassembly | |||||
PDGFR-beta signaling pathway | |||||
N-cadherin signaling events | |||||
Reactome | Integrin alphaIIb beta3 signaling | ||||
Regulation of IFNG signaling | |||||
Regulation of IFNA signaling | |||||
Growth hormone receptor signaling | |||||
WikiPathways | Insulin Signaling | ||||
Growth hormone receptor signaling | |||||
Leptin signaling pathway | |||||
Interferon gamma signaling | |||||
Interferon alpha/beta signaling | |||||
Integrin alphaIIb beta3 signaling | |||||
References | |||||
Ref 522516 | ClinicalTrials.gov (NCT00806338) An Ascending Multi-Dose, Tolerance and Pharmacokinetic Study in Obese or Overweight Type 2 Diabetic Volunteers. U.S. National Institutes of Health. | ||||
Ref 530636 | Inhibition of PTP1B by trodusquemine (MSI-1436) causes fat-specific weight loss in diet-induced obese mice. Obesity (Silver Spring). 2010 Aug;18(8):1516-23. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.