Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T76093
|
||||
| Former ID |
TTDNC00420
|
||||
| Target Name |
HB-EGF
|
||||
| Gene Name |
HBEGF
|
||||
| Synonyms |
DTR; Heparinbinding EGFlike growth factor; Proheparinbinding EGFlike growth factor; HBEGF
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Ovarian cancer [ICD9: 183; ICD10: C56] | ||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Growth factor that mediates its effects via EGFR,ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It ismitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Alsoacts as a diphtheria toxin receptor.
|
||||
| BioChemical Class |
Growth factor
|
||||
| UniProt ID | |||||
| Sequence |
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRK
VRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG LLMFRYHRRGGYDVENEEKVKLGMTNSH |
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | ErbB signaling pathway | ||||
| GnRH signaling pathway | |||||
| Estrogen signaling pathway | |||||
| Epithelial cell signaling in Helicobacter pylori infection | |||||
| Proteoglycans in cancer | |||||
| NetPath Pathway | IL5 Signaling Pathway | ||||
| IL1 Signaling Pathway | |||||
| EGFR1 Signaling Pathway | |||||
| TNFalpha Signaling Pathway | |||||
| PANTHER Pathway | EGF receptor signaling pathway | ||||
| CCKR signaling map ST | |||||
| Pathway Interaction Database | ErbB4 signaling events | ||||
| LPA receptor mediated events | |||||
| Plasma membrane estrogen receptor signaling | |||||
| ErbB receptor signaling network | |||||
| Reactome | SHC1 events in ERBB2 signaling | ||||
| PI3K events in ERBB4 signaling | |||||
| SHC1 events in ERBB4 signaling | |||||
| Nuclear signaling by ERBB4 | |||||
| PIP3 activates AKT signaling | |||||
| GRB2 events in ERBB2 signaling | |||||
| PI3K events in ERBB2 signaling | |||||
| EGFR Transactivation by Gastrin | |||||
| Constitutive Signaling by Aberrant PI3K in Cancer | |||||
| RAF/MAP kinase cascade | |||||
| WikiPathways | ErbB Signaling Pathway | ||||
| Hypertrophy Model | |||||
| NRF2 pathway | |||||
| Nuclear Receptors Meta-Pathway | |||||
| IL1 and megakaryotyces in obesity | |||||
| Signaling by ERBB4 | |||||
| Signaling by ERBB2 | |||||
| Gastrin-CREB signalling pathway via PKC and MAPK | |||||
| PIP3 activates AKT signaling | |||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.