Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T60724
|
||||
Former ID |
TTDNC00461
|
||||
Target Name |
Sclerostin
|
||||
Gene Name |
SOST
|
||||
Synonyms |
SOST
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Metabolic bone disease [ICD10: E50-E64, E70-E90] | ||||
Osteopenia [ICD9: 733.9; ICD10: M85.8] | |||||
Osteoporosis [ICD9: 733.0, V07.4; ICD10: M80-M81, Z79.890] | |||||
Postmenopausal osteoporosis [ICD9: 733; ICD10: M80-M81] | |||||
Function |
Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.
|
||||
BioChemical Class |
Sclerostin (SOST)
|
||||
UniProt ID | |||||
Sequence |
MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAE
NGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIG RGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELK DFGTEAARPQKGRKPRPRARSAKANQAELENAY |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Wnt signaling pathway | ||||
NetPath Pathway | TWEAK Signaling Pathway | ||||
Reactome | TCF dependent signaling in response to WNT | ||||
Negative regulation of TCF-dependent signaling by WNT ligand antagonists | |||||
References | |||||
Ref 523001 | ClinicalTrials.gov (NCT01101048) An Ascending Multiple Dose Study Evaluating AMG 167 in Healthy Men and Postmenopausal Women With Low Bone Mineral Density. U.S. National Institutes of Health. | ||||
Ref 523075 | ClinicalTrials.gov (NCT01144377) A Study of LY2541546 in Women With Low Bone Mineral Density. U.S. National Institutes of Health. | ||||
Ref 523960 | ClinicalTrials.gov (NCT01631214) Study to Determine the Efficacy and Safety of Romosozumab in the Treatment of Postmenopausal Women With Osteoporosis. U.S. National Institutes of Health. | ||||
Ref 531711 | Rat-specific decreases in platelet count caused by a humanized monoclonal antibody against sclerostin. Toxicol Sci. 2012 Feb;125(2):586-94. | ||||
Ref 532609 | Romosozumab in postmenopausal women with low bone mineral density. N Engl J Med. 2014 Jan 30;370(5):412-20. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.