Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T28717
|
||||
Former ID |
TTDI02196
|
||||
Target Name |
TNF superfamily receptor 12A
|
||||
Gene Name |
TNFRSF12A
|
||||
Synonyms |
CD266; FGF-inducible 14; Fibroblast growth factor-inducible immediate-early response protein 14; Tumor necrosis factor receptor superfamily member 12A; Tweak-receptor; TweakR; TNFRSF12A
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | ||||
Function |
Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins.
|
||||
BioChemical Class |
Cytokine receptor
|
||||
UniProt ID | |||||
Sequence |
MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPH
SDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGE GCPAVALIQ |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
Reactome | TNFR2 non-canonical NF-kB pathway | ||||
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway | |||||
WikiPathways | TWEAK Signaling Pathway | ||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.