Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T45758
|
||||
Former ID |
TTDC00188
|
||||
Target Name |
Tumor necrosisfactor receptor superfamily member 5
|
||||
Gene Name |
CD40
|
||||
Synonyms |
B-cell surfaceantigen CD40; Bp50; CD40L receptor; CDw40; CD40
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
Chronic lymphocytic leukaemia [ICD10: C91] | |||||
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
Transplant rejection [ICD9: 279.5, 996; ICD10: D89.8, T86] | |||||
Function |
Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.
|
||||
BioChemical Class |
Cytokine receptor
|
||||
Target Validation |
T45758
|
||||
UniProt ID | |||||
Sequence |
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
NF-kappa B signaling pathway | |||||
Cell adhesion molecules (CAMs) | |||||
Toll-like receptor signaling pathway | |||||
Intestinal immune network for IgA production | |||||
Malaria | |||||
Toxoplasmosis | |||||
HTLV-I infection | |||||
Epstein-Barr virus infection | |||||
Transcriptional misregulation in cancer | |||||
Asthma | |||||
Autoimmune thyroid disease | |||||
Systemic lupus erythematosus | |||||
Allograft rejection | |||||
Primary immunodeficiency | |||||
Viral myocarditis | |||||
Pathway Interaction Database | CD40/CD40L signaling | ||||
WikiPathways | Toll-like receptor signaling pathway | ||||
Inflammatory Response Pathway | |||||
NLR Proteins | |||||
Vitamin D Receptor Pathway | |||||
Human Complement System | |||||
Allograft Rejection | |||||
Regulation of toll-like receptor signaling pathway | |||||
References | |||||
Ref 468148 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5077). | ||||
Ref 525648 | Recombinant human CD40 ligand inhibits simian immunodeficiency virus replication: a role for interleukin- 16. J Med Primatol. 1999 Aug-Oct;28(4-5):190-4. | ||||
Ref 535147 | Growth-inhibitory effects of CD40 ligand (CD154) and its endogenous expression in human breast cancer. Clin Cancer Res. 2001 Mar;7(3):691-703. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.