Target General Infomation
Target ID
T45758
Former ID
TTDC00188
Target Name
Tumor necrosisfactor receptor superfamily member 5
Gene Name
CD40
Synonyms
B-cell surfaceantigen CD40; Bp50; CD40L receptor; CDw40; CD40
Target Type
Clinical Trial
Disease Autoimmune diabetes [ICD10: E08-E13]
Chronic lymphocytic leukaemia [ICD10: C91]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Transplant rejection [ICD9: 279.5, 996; ICD10: D89.8, T86]
Function
Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.
BioChemical Class
Cytokine receptor
Target Validation
T45758
UniProt ID
Sequence
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN
KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD
DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Drugs and Mode of Action
Drug(s) ASKP-1240 Drug Info Phase 2 Transplant rejection [523885]
HuCD40L Drug Info Terminated Solid tumours [468148], [546452]
RhuCD40L Drug Info Terminated Discovery agent [546452]
Antagonist Anti-CD40-XTEN Drug Info [543514]
Binder CD154 Drug Info [535147]
HuCD40L Drug Info [525648]
RhuCD40L Drug Info [535281]
Agonist Human CD40 agonist ligand Drug Info [543514]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Cell adhesion molecules (CAMs)
Toll-like receptor signaling pathway
Intestinal immune network for IgA production
Malaria
Toxoplasmosis
HTLV-I infection
Epstein-Barr virus infection
Transcriptional misregulation in cancer
Asthma
Autoimmune thyroid disease
Systemic lupus erythematosus
Allograft rejection
Primary immunodeficiency
Viral myocarditis
Pathway Interaction Database CD40/CD40L signaling
WikiPathways Toll-like receptor signaling pathway
Inflammatory Response Pathway
NLR Proteins
Vitamin D Receptor Pathway
Human Complement System
Allograft Rejection
Regulation of toll-like receptor signaling pathway
References
Ref 468148(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5077).
Ref 523885ClinicalTrials.gov (NCT01585233) A Multiple Dose Escalation Study of ASKP1240 in Subjects With Moderate to Severe Plaque Psoriasis. U.S. National Institutes of Health.
Ref 546452Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008196)
Ref 525648Recombinant human CD40 ligand inhibits simian immunodeficiency virus replication: a role for interleukin- 16. J Med Primatol. 1999 Aug-Oct;28(4-5):190-4.
Ref 535147Growth-inhibitory effects of CD40 ligand (CD154) and its endogenous expression in human breast cancer. Clin Cancer Res. 2001 Mar;7(3):691-703.
Ref 535281Recombinant CD40 ligand therapy has significant antitumor effects on CD40-positive ovarian tumor xenografts grown in SCID mice and demonstrates an augmented effect with cisplatin. Cancer Res. 2001 Oct 15;61(20):7556-62.
Ref 543514(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1874).

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.