Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T18872
|
||||
Former ID |
TTDR01010
|
||||
Target Name |
Malignant melanoma metastasis-suppressor KiSS-1
|
||||
Gene Name |
KISS1
|
||||
Synonyms |
KiSS-1; KISS1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Prostate cancer [ICD9: 185; ICD10: C61] | ||||
Function |
Metastasis suppressor protein in malignant melanomas and in some breast cancers. May regulate events downstream of cell- matrix adhesion, perhaps involving cytoskeletal reorganization. Generates a C-terminally amidated peptide, metastin which functions as the endogenous ligand of the G-protein coupled receptor GPR54. Activation of the receptor inhibits cell proliferation and cell migration, key characteristics of tumor metastasis. Kp-10 is a decapeptide derived from the primary translation product, isolated in conditioned medium of first trimester trophoblast. Kp-10, but not other kisspeptins, increased intracellular Ca(2+) levels in isolated first trimester trophoblasts. Kp-10 is a paracrine/endocrine regulator in fine- tuning trophoblast invasion generated by the trophoblast itself. The receptor is also essential for normal gonadotropin-released hormone physiology and for puberty. The hypothalamic KiSS1/GPR54 system is a pivotal factor in central regulation of the gonadotropic axis at puberty and in adulthood.
|
||||
BioChemical Class |
Kisspeptin
|
||||
UniProt ID | |||||
Sequence |
MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAA
TARLSRRGTSLSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLR FGKREAAPGNHGRSAGRG |
||||
Drugs and Mode of Action | |||||
Modulator | TAK-448 | Drug Info | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.