Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T59929
|
||||
Former ID |
TTDR00251
|
||||
Target Name |
Thymidine phosphorylase
|
||||
Gene Name |
TYMP
|
||||
Synonyms |
Gliostatin; PD-ECGF; PDECGF; Platelet-derived endothelial cell growth factor; TP; TdRPase; TYMP
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Depression [ICD9: 311; ICD10: F30-F39] | ||||
Function |
Catalyzes the reversible phosphorolysis of thymidine. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
|
||||
BioChemical Class |
Pentosyltransferase
|
||||
Target Validation |
T59929
|
||||
UniProt ID | |||||
EC Number |
EC 2.4.2.4
|
||||
Sequence |
MAALMTPGTGAPPAPGDFSGEGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAA
VVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGG VGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQA GCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAA VFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPP DLRDLVTTLGGALLWLSGHAGTQAQGAARVAAALDDGSALGRFERMLAAQGVDPGLARAL CSGSPAERRQLLPRAREQEELLAPADGTVELVRALPLALVLHELGAGRSRAGEPLRLGVG AELLVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQEALVLSDRAPFAAPSPFAELVLPP |
||||
Drugs and Mode of Action | |||||
Inhibitor | 1-(cyclohexyl)methyl-5'-O-tritylinosine | Drug Info | [528407] | ||
1-(cyclopropyl)methyl-5'-O-tritylinosine | Drug Info | [528407] | |||
1-allyl-5'-O-tritylinosine | Drug Info | [528407] | |||
1-benzyl-5'-O-tritylinosine | Drug Info | [528407] | |||
1-propyl-5'-O-tritylinosine | Drug Info | [528407] | |||
2'-aminoimidazolylmethyluracils | Drug Info | [535670] | |||
5-benzyl-6-chloropyrimidine-2,4(1H,3H)-dione | Drug Info | [529120] | |||
5-bromo-6-(cyclopropylamino)uracil hydrochloride | Drug Info | [527920] | |||
5-bromo-6-hydrazinouracil hydrochloride | Drug Info | [527920] | |||
5-butyl-6-chloropyrimidine-2,4(1H,3H)-dione | Drug Info | [529120] | |||
5-chloro-6-hydrazinouracil hydrochloride | Drug Info | [527920] | |||
5-fluoro-6-[(2-aminoimidazol-1-yl)methyl]uracil | Drug Info | [530697] | |||
6-amino-5-bromouracil | Drug Info | [529048] | |||
6-amino-5-chlorouracil hydrochloride | Drug Info | [527920] | |||
6-bromo-5-phenylpyrimidine-2,4(1H,3H)-dione | Drug Info | [529120] | |||
6-chloro-5-(2-thienyl)pyrimidine-2,4(1H,3H)-dione | Drug Info | [529120] | |||
6-chloro-5-heptylpyrimidine-2,4(1H,3H)-dione | Drug Info | [529120] | |||
6-chloro-5-hexylpyrimidine-2,4(1H,3H)-dione | Drug Info | [529120] | |||
6-chloro-5-pentylpyrimidine-2,4(1H,3H)-dione | Drug Info | [529120] | |||
6-chloro-5-phenylpyrimidine-2,4(1H,3H)-dione | Drug Info | [529120] | |||
6-chloro-5-propylpyrimidine-2,4(1H,3H)-dione | Drug Info | [529120] | |||
6-fluoro-5-phenylpyrimidine-2,4(1H,3H)-dione | Drug Info | [529120] | |||
Thymine | Drug Info | [551393] | |||
Uridine | Drug Info | [536519] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | Pyrimidine deoxyribonucleosides degradation | ||||
KEGG Pathway | Pyrimidine metabolism | ||||
Drug metabolism - other enzymes | |||||
Metabolic pathways | |||||
Bladder cancer | |||||
NetPath Pathway | TSH Signaling Pathway | ||||
PathWhiz Pathway | Pyrimidine Metabolism | ||||
WikiPathways | Bladder Cancer | ||||
Metabolism of nucleotides | |||||
Fluoropyrimidine Activity | |||||
References | |||||
Ref 527920 | Bioorg Med Chem Lett. 2006 Mar 1;16(5):1335-7. Epub 2005 Dec 5.Design and synthesis of novel 5,6-disubstituted uracil derivatives as potent inhibitors of thymidine phosphorylase. | ||||
Ref 528407 | J Med Chem. 2006 Sep 7;49(18):5562-70.5'-O-tritylinosine and analogues as allosteric inhibitors of human thymidine phosphorylase. | ||||
Ref 529048 | Eur J Med Chem. 2008 Jun;43(6):1248-60. Epub 2007 Aug 6.Xanthine oxidase-activated prodrugs of thymidine phosphorylase inhibitors. | ||||
Ref 529120 | J Med Chem. 2007 Nov 29;50(24):6016-23. Epub 2007 Oct 27.Discovery of 5-substituted-6-chlorouracils as efficient inhibitors of human thymidine phosphorylase. | ||||
Ref 530697 | Bioorg Med Chem Lett. 2010 Mar 1;20(5):1648-51. Epub 2010 Jan 21.The role of phosphate in the action of thymidine phosphorylase inhibitors: Implications for the catalytic mechanism. | ||||
Ref 535670 | Potential tumor-selective nitroimidazolylmethyluracil prodrug derivatives: inhibitors of the angiogenic enzyme thymidine phosphorylase. J Med Chem. 2003 Jan 16;46(2):207-9. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.