Target Information

Target General Infomation
Target ID
T67805
Former ID
TTDC00337
Target Name
CD70
Gene Name
CD70
Synonyms
CD27 ligand; CD27-L; CD70 antigen; Tumor necrosis factor ligandsuperfamily member 7; CD70
Target Type
Clinical Trial
Disease Autoimmune diabetes [ICD10: E08-E13]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Hematological malignancies [ICD9: 200-209; ICD10: C81-C86]
Melanoma [ICD9: 172; ICD10: C43]
Non-hodgkin's lymphoma [ICD10: C85]
Renal cancer [ICD9: 140-229, 189; ICD10: C64]
Function
Cytokine that binds to CD27.Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
BioChemical Class
Cytokine: tumor necrosis factor
UniProt ID
P32970
Sequence
MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAEL
QLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTA
SRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRN
TDETFFGVQWVRP
Drugs and Mode of Action
Drug(s) AMG 172 Drug Info Phase 1 Renal cancer [523744]
BMS-936561 Drug Info Phase 1 Hematological malignancies [549690]
MDX-1203 Drug Info Phase 1 Cancer [522737]
MDX-1411 Drug Info Phase 1 Cancer [522399]
SGN-70 Drug Info Phase 1 Autoimmune diabetes [551669]
SGN-CD70A Drug Info Phase 1 Non-hodgkin's lymphoma [524874]
Vorsetuzumab mafodotin Drug Info Discontinued in Phase 1 Renal cancer [547915]
Modulator AMG 172 Drug Info [550482]
BMS-936561 Drug Info [533210]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
NetPath Pathway IL2 Signaling Pathway
TNFalpha Signaling Pathway
RANKL Signaling Pathway
Reactome TNFs bind their physiological receptors
References
Ref 522399ClinicalTrials.gov (NCT00730652) Study of MDX-1411 in Patients With Relapsed/Refractory Chronic Lymphocytic Leukemia or Mantle Cell Lymphoma. U.S. National Institutes of Health.
Ref 522737ClinicalTrials.gov (NCT00944905) Study of MDX-1203 in Subjects With Advanced/Recurrent Clear Cell Renal Cell Carcinoma (ccRCC) or Relapsed/Refractory B-Cell Non-Hodgkin's Lymphoma (B-NHL). U.S. National Institutes of Health.
Ref 523744ClinicalTrials.gov (NCT01497821) AMG 172 First in Human Study in Patients With Kidney Cancer. U.S. National Institutes of Health.
Ref 524874ClinicalTrials.gov (NCT02216890) Safety Study of SGN-CD70A in Cancer Patients. U.S. National Institutes of Health.
Ref 547915Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020387)
Ref 549690J Clin Oncol 32:5s, 2014 (suppl, abstr 2558).
Ref 5516692011 Pipeline of Seattle Genetics.
Ref 530370Bristol-Myers Squibb swallows last of antibody pioneers. Nat Biotechnol. 2009 Sep;27(9):781-3.
Ref 532273Characterization of CD8+ T-cell responses in the peripheral blood and skin injection sites of melanoma patients treated with mRNA electroporated autologous dendritic cells (TriMixDC-MEL). Biomed Res Int. 2013;2013:976383.
Ref 533210Pharmacokinetic characterization of BMS-936561, an anti-CD70 antibody-drug conjugate, in preclinical animal species and prediction of its pharmacokinetics in humans. Biopharm Drug Dispos. 2015 Apr 13.
Ref 549691J Clin Oncol 32:5s, 2014 (suppl; abstr 2558).
Ref 549769SGN-CD70A, a novel and highly potent anti-CD70 ADC, induces double-strand DNA breaks and is active in models of MDR+ renal cell carcinoma (RCC) and non-Hodgkin lymphoma (NHL). Cancer Research 10/2014; 74(19 Supplement):2647-2647.
Ref 550448National Cancer Institute Drug Dictionary (drug id 660730).
Ref 550482National Cancer Institute Drug Dictionary (drug id 721679).
Ref 5516692011 Pipeline of Seattle Genetics.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.