Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T83376
|
||||
Former ID |
TTDI02202
|
||||
Target Name |
Tumor suppressor candidate 2
|
||||
Gene Name |
TUSC2
|
||||
Synonyms |
Fus-1 protein; Fusion 1 protein; PDGFA-associated protein 2; TUSC2
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Non-small cell lung cancer [ICD10: C33-C34] | ||||
Function |
May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells.
|
||||
BioChemical Class |
Tumour suppressor candidate 2
|
||||
UniProt ID | |||||
Sequence |
MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLA
HEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.