Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T06182
|
||||
Former ID |
TTDI02208
|
||||
Target Name |
VIP 2 receptor
|
||||
Gene Name |
VIPR2
|
||||
Synonyms |
Helodermin-preferring VIP receptor; PACAP type III receptor; PACAP-R-3; PACAP-R3; Pituitary adenylate cyclase-activating polypeptide typeIII receptor; VIP-R-2; VPAC2; Vasoactive intestinal polypeptide receptor 2; VIPR2
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47] | ||||
Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
Unspecified [ICD code not available] | |||||
Function |
This is a receptor for VIP as well as PACAP-38 and -27,the activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Can be coupled to phospholipase C.
|
||||
BioChemical Class |
GPCR secretin
|
||||
UniProt ID | |||||
Sequence |
MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNIT
CWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKI TFYILVKAIYTLGYSVSLMSLATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKD DVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRC FLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFI SIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILFE LCLGSFQGLVVAVLYCFLNSEVQCELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQ FHRGSRAQSFLQTETSVI |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | cAMP signaling pathway | ||||
Neuroactive ligand-receptor interaction | |||||
NetPath Pathway | TCR Signaling Pathway | ||||
Reactome | G alpha (s) signalling events | ||||
WikiPathways | SIDS Susceptibility Pathways | ||||
GPCRs, Class B Secretin-like | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
Ref 528390 | A systematic comparison of intracellular cyclic AMP and calcium signalling highlights complexities in human VPAC/PAC receptor pharmacology. Neuropharmacology. 2006 Nov;51(6):1086-98. Epub 2006 Aug 23. | ||||
Ref 534825 | Analogues of VIP, helodermin, and PACAP discriminate between rat and human VIP1 and VIP2 receptors. Ann N Y Acad Sci. 1998 Dec 11;865:247-52. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.