Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T67894
|
||||
Former ID |
TTDC00007
|
||||
Target Name |
Toll-like receptor 3
|
||||
Gene Name |
TLR3
|
||||
Synonyms |
CD283; TLR3
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Anal intraepithelial neoplasia; Human papillomavirus infections [ICD9:154, 078.1079.4; ICD10: C21, B97.7] | ||||
Autoimmune diabetes [ICD10: E08-E13] | |||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Glioblastoma multiforme [ICD9: 191; ICD10: C71] | |||||
Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | |||||
Keratosis [ICD10: L57.0] | |||||
Function |
Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR3 is a nucleotide-sensing TLR which is activated by double-stranded RNA, a sign of viral infection. Acts via the adapter TRIF/TICAM1, leading to NF-kappa-B activation, IRF3 nuclear translocation, cytokine secretion and the inflammatory response.
|
||||
BioChemical Class |
Toll-like receptor family
|
||||
Target Validation |
T67894
|
||||
UniProt ID | |||||
Sequence |
MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTH
NQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFA FCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSN NKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEK LCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQL EYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHL NMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKIS KIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVP SLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHN NLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNT LPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNW INETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFIV LLIHFEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKE DQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAI EQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSK NSVH |
||||
Drugs and Mode of Action | |||||
Drug(s) | Rintatolimod | Drug Info | Phase 3 | Human immunodeficiency virus infection | [524780] |
Poly-ICLC | Drug Info | Phase 2 | Glioblastoma multiforme | [528669] | |
BCG65-E7 | Drug Info | Discontinued in Phase 3 | Anal intraepithelial neoplasia; Human papillomavirus infections | [546672] | |
IPH-3102 | Drug Info | Terminated | Cancer | [549463] | |
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Toll-like receptor signaling pathway | ||||
Hepatitis C | |||||
Hepatitis B | |||||
Influenza A | |||||
Herpes simplex infection | |||||
NetPath Pathway | TCR Signaling Pathway | ||||
PANTHER Pathway | Toll receptor signaling pathway | ||||
Pathway Interaction Database | Endogenous TLR signaling | ||||
Reactome | Ligand-dependent caspase activation | ||||
MyD88-independent TLR3/TLR4 cascade | |||||
Trafficking and processing of endosomal TLR | |||||
RIP-mediated NFkB activation via ZBP1 | |||||
TRIF-mediated programmed cell death | |||||
Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon | |||||
IKK complex recruitment mediated by RIP1 | |||||
TRAF6 mediated induction of TAK1 complex | |||||
WikiPathways | Toll-like receptor signaling pathway | ||||
Cytosolic sensors of pathogen-associated DNA | |||||
Toll-Like Receptors Cascades | |||||
MyD88-independent cascade | |||||
Trafficking and processing of endosomal TLR | |||||
Regulation of toll-like receptor signaling pathway | |||||
References | |||||
Ref 524780 | ClinicalTrials.gov (NCT02151448) alphaDC1 Vaccine + Chemokine Modulatory Regimen (CKM) as Adjuvant Treatment of Peritoneal Surface Malignancies. U.S. National Institutes of Health. | ||||
Ref 528669 | Toll like receptor-3 ligand poly-ICLC promotes the efficacy of peripheral vaccinations with tumor antigen-derived peptide epitopes in murine CNS tumor models. J Transl Med. 2007 Feb 12;5:10. | ||||
Ref 526173 | Recognition of double-stranded RNA and activation of NF-kappaB by Toll-like receptor 3. Nature. 2001 Oct 18;413(6857):732-8. | ||||
Ref 528669 | Toll like receptor-3 ligand poly-ICLC promotes the efficacy of peripheral vaccinations with tumor antigen-derived peptide epitopes in murine CNS tumor models. J Transl Med. 2007 Feb 12;5:10. | ||||
Ref 531850 | A double-blind, placebo-controlled, randomized, clinical trial of the TLR-3 agonist rintatolimod in severe cases of chronic fatigue syndrome. PLoS One. 2012;7(3):e31334. | ||||
Ref 537086 | Medical treatment of cervical intraepithelial neoplasia II, III: an update review. Int J Clin Oncol. 2009 Feb;14(1):37-42. Epub 2009 Feb 20. | ||||
Ref 537528 | Serological response to an HPV16 E7 based therapeutic vaccine in women with high-grade cervical dysplasia. Gynecol Oncol. 2009 Jun 23. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.