Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T86014
|
||||
Former ID |
TTDI02179
|
||||
Target Name |
Sphingosine kinase
|
||||
Gene Name |
SPHK1
|
||||
Synonyms |
SK 1; SPK 1; SPHK1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Arteriosclerosis [ICD9: 440; ICD10: I70] | ||||
Late-stage ovarian cancer; Lymphoma [ICD9:140-229, 183, 188, 202.8, 208.9; ICD10: C56, C67, C81-C86] | |||||
Vascular disease [ICD9: 325, 430-459; ICD10: G45-G46, I60-I95] | |||||
Function |
Catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. Also acts on D-erythro-sphingosine and to a lesser extent sphinganine, but not other lipids,such as D,L-threo-dihydrosphingosine, N,N-dimethylsphingosine, diacylglycerol, ceramide, or phosphatidylinositol.
|
||||
BioChemical Class |
Kinase
|
||||
UniProt ID | |||||
EC Number |
EC 2.7.1.91
|
||||
Sequence |
MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHA
RELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASL NHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLE SEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVP LEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLL RLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFW MVSGCVEPPPSWKPQQMPPPEEPL |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | Sphingosine and sphingosine-1-phosphate metabolism | ||||
KEGG Pathway | Sphingolipid metabolism | ||||
Metabolic pathways | |||||
Calcium signaling pathway | |||||
Sphingolipid signaling pathway | |||||
VEGF signaling pathway | |||||
Fc gamma R-mediated phagocytosis | |||||
Tuberculosis | |||||
NetPath Pathway | TCR Signaling Pathway | ||||
TNFalpha Signaling Pathway | |||||
PANTHER Pathway | Angiogenesis | ||||
VEGF signaling pathway | |||||
Pathway Interaction Database | Fc-epsilon receptor I signaling in mast cells | ||||
Beta3 integrin cell surface interactions | |||||
S1P1 pathway | |||||
Sphingosine 1-phosphate (S1P) pathway | |||||
PDGFR-beta signaling pathway | |||||
Reactome | Sphingolipid de novo biosynthesis | ||||
VEGFR2 mediated cell proliferation | |||||
WikiPathways | Signal Transduction of S1P Receptor | ||||
Protein folding | |||||
Sphingolipid Metabolism | |||||
References | |||||
Ref 521895 | ClinicalTrials.gov (NCT00382811) OVATURE (OVArian TUmor REsponse) A Phase III Study of Weekly Carboplatin With and Without Phenoxodiol in Patients With Platinum-Resistant, Recurrent Epithelial Ovarian Cancer. U.S. National Institutes of Health. | ||||
Ref 525833 | F-12509A, a new sphingosine kinase inhibitor, produced by a discomycete. J Antibiot (Tokyo). 2000 May;53(5):459-66. | ||||
Ref 525910 | Characterization of B-5354c, a new sphingosine kinase inhibitor, produced by a marine bacterium. J Antibiot (Tokyo). 2000 Aug;53(8):759-64. | ||||
Ref 529501 | A selective sphingosine kinase 1 inhibitor integrates multiple molecular therapeutic targets in human leukemia. Blood. 2008 Aug 15;112(4):1382-91. | ||||
Ref 531834 | Modulation of cellular S1P levels with a novel, potent and specific inhibitor of sphingosine kinase-1. Biochem J. 2012 May 15;444(1):79-88. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.