Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T96627
|
||||
| Former ID |
TTDC00225
|
||||
| Target Name |
Macrophage inflammatory protein-2-alpha
|
||||
| Gene Name |
CXCL2
|
||||
| Synonyms |
Gro-beta; Growth regulatedprotein beta; MIP2-alpha; Macrophage inflammatory protein 2; CXCL2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Multiple scierosis [ICD9: 340; ICD10: G35] | ||||
| Function |
Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity.
|
||||
| BioChemical Class |
Intercrine-alpha family
|
||||
| Target Validation |
T96627
|
||||
| UniProt ID | |||||
| Sequence |
MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV
KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| Chemokine signaling pathway | |||||
| NF-kappa B signaling pathway | |||||
| NOD-like receptor signaling pathway | |||||
| TNF signaling pathway | |||||
| Salmonella infection | |||||
| Legionellosis | |||||
| NetPath Pathway | IL-7 Signaling Pathway | ||||
| IL1 Signaling Pathway | |||||
| IL4 Signaling Pathway | |||||
| TNFalpha Signaling Pathway | |||||
| IL5 Signaling Pathway | |||||
| PANTHER Pathway | CCKR signaling map ST | ||||
| Reactome | Chemokine receptors bind chemokines | ||||
| G alpha (i) signalling events | |||||
| WikiPathways | Cytokines and Inflammatory Response | ||||
| Spinal Cord Injury | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.