Resistance mutation info of target
Target General Information | ||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Target ID | T52617 | |||||||||||||||||
Target Name | Bacterial 3-oxoacyl-[acyl-carrier-protein] synthase 1 (kasA) | Target Info | ||||||||||||||||
Gene Name | kasA | |||||||||||||||||
Species | Mycobacterium tuberculosis | |||||||||||||||||
Uniprot ID | FAB1_MYCTU | |||||||||||||||||
Sequence | MSQPSTANGGFPSVVVTAVTATTSISPDIESTWKGLLAGESGIHALEDEFVTKWDLAVKI GGHLKDPVDSHMGRLDMRRMSYVQRMGKLLGGQLWESAGSPEVDPDRFAVVVGTGLGGAE RIVESYDLMNAGGPRKVSPLAVQMIMPNGAAAVIGLQLGARAGVMTPVSACSSGSEAIAH AWRQIVMGDADVAVCGGVEGPIEALPIAAFSMMRAMSTRNDEPERASRPFDKDRDGFVFG EAGALMLIETEEHAKARGAKPLARLLGAGITSDAFHMVAPAADGVRAGRAMTRSLELAGL SPADIDHVNAHGTATPIGDAAEANAIRVAGCDQAAVYAPKSALGHSIGAVGALESVLTVL TLRDGVIPPTLNYETPDPEIDLDVVAGEPRYGDYRYAVNNSFGFGGHNVALAFGRY [My cobacterium tuberculosis] |
|||||||||||||||||
Drug Resistance Mutation and Corresponding Drugs | ||||||||||||||||||
Mutation Info | Missense: D66N | |||||||||||||||||
Drugs |
|
|||||||||||||||||
Mutation Info | Missense: F413L | |||||||||||||||||
Drugs |
|
|||||||||||||||||
Mutation Info | Missense: G269S | |||||||||||||||||
Drugs |
|
|||||||||||||||||
Mutation Info | Missense: G312S | |||||||||||||||||
Drugs |
|
|||||||||||||||||
Mutation Info | Missense: G387D | |||||||||||||||||
Drugs |
|
|||||||||||||||||
Mutation Info | Missense: M77I | |||||||||||||||||
Drugs |
|
|||||||||||||||||
Mutation Info | Missense: R121K | |||||||||||||||||
Drugs |
|
|||||||||||||||||
Reference | ||||||||||||||||||
REF 1 | Inhibition of a Mycobacterium tuberculosis beta-ketoacyl ACP synthase by isoniazid. Science. 1998 Jun 5;280(5369):1607-10. | |||||||||||||||||
REF 2 | Bioinformatics of antimicrobial resistance in the age of molecular epidemiology. Curr Opin Microbiol. 2015 Oct;27:45-50. doi: 10.1016/j.mib.2015.07.004. Epub 2015 Jul 31. | |||||||||||||||||
REF 3 | Contribution of kasA analysis to detection of isoniazid-resistant Mycobacterium tuberculosis in Singapore. Antimicrob Agents Chemother. 1999 Aug;43(8):2087-9. | |||||||||||||||||
REF 4 | Single nucleotide polymorphisms in genes associated with isoniazid resistance in Mycobacterium tuberculosis. Antimicrob Agents Chemother. 2003 Apr;47(4):1241-50. | |||||||||||||||||
REF 5 | CARD 2017: expansion and model-centric curation of the comprehensive antibiotic resistance database. Nucleic Acids Res. 2017 Jan 4;45(D1):D566-D573. doi: 10.1093/nar/gkw1004. Epub 2016 Oct 26. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.