Target General Infomation
Target ID
T99908
Target Name
HUMAN transmembrane protease serine 2 (TMPRSS2)
Synonyms
TMPRSS2 protease; TMPRSS2
Gene Name
TMPRSS2
Target Status
Target in Phase 2 Trial
[1]
Disease [+] 3 Target-related Diseases +
1 COVID-19 [ICD-11: 1D6Y]
2 Middle East Respiratory Syndrome [ICD-11: 1D64]
3 Severe acute respiratory syndrome [ICD-11: 1D65]
Function
Serine protease that proteolytically cleaves and activates the viral spike glycoproteins which facilitate virus- cell membrane fusions; spike proteins are synthesized and maintained in precursor intermediate folding states and proteolysis permits the refolding and energy release required to create stable virus-cell linkages and membrane coalescence. Facilitates human SARS coronavirus (SARS-CoV) infection via two independent mechanisms, proteolytic cleavage of ACE2, which might promote viral uptake, and cleavage of coronavirus spike glycoprotein which activates the glycoprotein for cathepsin L- independent host cell entry. Proteolytically cleaves and activates the spike glycoproteins of human coronavirus 229E (HCoV-229E) and human coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0 of Sendai virus (SeV), human metapneumovirus (HMPV), human parainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential for spread and pathogenesis of influenza A virus (strains H1N1, H3N2 and H7N9); involved in proteolytic cleavage and activation of hemagglutinin (HA) protein which is essential for viral infectivity.
BioChemical Class
Peptidase
UniProt ID
TMPS2_HUMAN
EC Number
EC 3.4.21.-
Sequence
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQA
SNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIEC
DSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
GRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLR
CIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEK
PLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL
VKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLI
TPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVF
TDWIYRQMRADG
Drugs and Modes of Action
Drugs in Phase 2 Trial [+] 1 Drugs in Phase 2 Trial +
1 Camostat mesylate Drug Info Phase 2 Trial COVID-19 [2], [3]
Mode of Action [+] 1 Modes of Action +
Inhibitor [+] 1 Inhibitor drugs +
1 Camostat mesylate Drug Info [1], [2]
Tissue/Disease-Specific Protein Abundances of This Target
      Tissue-specific Protein Abundances in Healthy Individuals Click to Show/Hide
      ICD Disease Classification 01 Certain infectious or parasitic disease Click to Show/Hide
                  ICD-11: 1C1H     Necrotising ulcerative gingivitis Click to Show/Hide
The Studied Tissue     Gingival tissue
The Specified Disease     Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.59E-11; Fold-change: 0.723947931; Z-score: 1.232231229
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 1E30     Influenza Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.001136951; Fold-change: 0.401292015; Z-score: 9.483034755
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 1E51     Chronic viral hepatitis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.831119667; Fold-change: -0.002747759; Z-score: -0.019789304
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 1G41     Sepsis with septic shock Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.004066754; Fold-change: 0.035785555; Z-score: 0.216348214
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA40     Respiratory syncytial virus infection Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.34838279; Fold-change: -0.053207312; Z-score: -0.542519518
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA42     Rhinovirus infection Click to Show/Hide
The Studied Tissue     Nasal epithelium tissue
The Specified Disease     Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.907876493; Fold-change: -0.022036061; Z-score: -0.129938079
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: KA60     Neonatal sepsis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.065009507; Fold-change: -0.065425742; Z-score: -0.366736534
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 02 Neoplasm Click to Show/Hide
                  ICD-11: 2A00     Brain cancer Click to Show/Hide
The Studied Tissue     Nervous tissue
The Specified Disease     Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.50E-05; Fold-change: -0.050702525; Z-score: -0.195404292
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Brain stem tissue
The Specified Disease     Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.806812099; Fold-change: -0.029941414; Z-score: -0.204883597
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     White matter tissue
The Specified Disease     Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.000763787; Fold-change: -0.430876269; Z-score: -2.026798528
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Brain stem tissue
The Specified Disease     Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.011088556; Fold-change: -0.591124341; Z-score: -1.370949661
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2A20     Myeloproliferative neoplasm Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.021672739; Fold-change: -0.151804524; Z-score: -1.408153509
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Whole blood
The Specified Disease     Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.460463355; Fold-change: -0.002004502; Z-score: -0.015938402
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2A36     Myelodysplastic syndrome Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.599106698; Fold-change: 0.01255658; Z-score: 0.065271747
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.059482054; Fold-change: -0.270131117; Z-score: -1.758336315
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2A81     Diffuse large B-cell lymphoma Click to Show/Hide
The Studied Tissue     Tonsil tissue
The Specified Disease     Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.710917694; Fold-change: -0.011969921; Z-score: -0.077249997
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2A83     Plasma cell neoplasm Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.103328797; Fold-change: -0.123079144; Z-score: -0.625351944
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Peripheral blood
The Specified Disease     Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.481106599; Fold-change: 0.016467246; Z-score: 0.123161041
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B33     Leukaemia Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.5991753; Fold-change: 0.017428462; Z-score: 0.116472612
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B6E     Oral cancer Click to Show/Hide
The Studied Tissue     Oral tissue
The Specified Disease     Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.99E-06; Fold-change: -0.858041985; Z-score: -1.164468758
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 2.74E-20; Fold-change: -0.991669374; Z-score: -1.346974016
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B70     Esophageal cancer Click to Show/Hide
The Studied Tissue     Esophagus
The Specified Disease     Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.72195282; Fold-change: -0.747172669; Z-score: -0.91093087
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B72     Stomach cancer Click to Show/Hide
The Studied Tissue     Gastric tissue
The Specified Disease     Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.451950609; Fold-change: -1.491060684; Z-score: -0.929847085
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 2.05E-05; Fold-change: -1.046732665; Z-score: -1.495898649
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B90     Colon cancer Click to Show/Hide
The Studied Tissue     Colon tissue
The Specified Disease     Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.63E-89; Fold-change: -1.466400859; Z-score: -2.885020304
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 2.38E-24; Fold-change: -1.249885381; Z-score: -1.362842695
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B92     Rectal cancer Click to Show/Hide
The Studied Tissue     Rectal colon tissue
The Specified Disease     Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.41E-08; Fold-change: -0.416717247; Z-score: -3.976726033
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 4.42E-05; Fold-change: -0.845571566; Z-score: -2.862535485
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C10     Pancreatic cancer Click to Show/Hide
The Studied Tissue     Pancreas
The Specified Disease     Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.448452071; Fold-change: -0.179822874; Z-score: -0.159782849
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.016662492; Fold-change: -0.842204117; Z-score: -0.688521443
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C12     Liver cancer Click to Show/Hide
The Studied Tissue     Liver tissue
The Specified Disease     Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.000283633; Fold-change: -0.309211377; Z-score: -0.610400928
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 9.43E-27; Fold-change: -0.54542273; Z-score: -1.019357344
The Expression Level of Disease Section Compare with the Other Disease Section     p-value: 0.202562467; Fold-change: -0.636965694; Z-score: -0.659006184
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Target expression in tissue other than the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C25     Lung cancer Click to Show/Hide
The Studied Tissue     Lung tissue
The Specified Disease     Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.86E-73; Fold-change: -1.093412977; Z-score: -2.130065726
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 1.30E-25; Fold-change: -0.865786675; Z-score: -1.243038179
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C30     Skin cancer Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.350010038; Fold-change: 0.062253589; Z-score: 0.098415546
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Skin
The Specified Disease     Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.69E-37; Fold-change: -0.582934195; Z-score: -1.112992778
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.998667791; Fold-change: 0.189109475; Z-score: 0.385964905
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C6Z     Breast cancer Click to Show/Hide
The Studied Tissue     Breast tissue
The Specified Disease     Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.78E-11; Fold-change: -0.329931376; Z-score: -0.570568425
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 8.59E-05; Fold-change: -0.499324689; Z-score: -0.646068871
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C73     Ovarian cancer Click to Show/Hide
The Studied Tissue     Ovarian tissue
The Specified Disease     Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.594526017; Fold-change: 0.015917684; Z-score: 0.036532201
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.137440123; Fold-change: 0.071816625; Z-score: 0.225584001
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C77     Cervical cancer Click to Show/Hide
The Studied Tissue     Cervical tissue
The Specified Disease     Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.012553544; Fold-change: -0.336468847; Z-score: -0.568157391
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C78     Uterine cancer Click to Show/Hide
The Studied Tissue     Endometrium tissue
The Specified Disease     Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.001908017; Fold-change: 0.1030457; Z-score: 0.251403185
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.964774696; Fold-change: 0.063021469; Z-score: 0.070354838
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C82     Prostate cancer Click to Show/Hide
The Studied Tissue     Prostate
The Specified Disease     Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.528071867; Fold-change: -1.052157568; Z-score: -0.548649855
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C90     Renal cancer Click to Show/Hide
The Studied Tissue     Kidney
The Specified Disease     Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.65E-07; Fold-change: -1.761781329; Z-score: -3.94828696
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 1.56E-46; Fold-change: -1.994381408; Z-score: -3.738014093
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C92     Ureter cancer Click to Show/Hide
The Studied Tissue     Urothelium
The Specified Disease     Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.217019011; Fold-change: -0.129927355; Z-score: -0.254209111
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C94     Bladder cancer Click to Show/Hide
The Studied Tissue     Bladder tissue
The Specified Disease     Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.008943146; Fold-change: -0.986741849; Z-score: -1.862520255
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2D02     Retinal cancer Click to Show/Hide
The Studied Tissue     Uvea
The Specified Disease     Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.043009099; Fold-change: -0.212112709; Z-score: -1.771659265
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2D10     Thyroid cancer Click to Show/Hide
The Studied Tissue     Thyroid
The Specified Disease     Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.813608477; Fold-change: -0.029512099; Z-score: -0.093333291
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.039846995; Fold-change: -0.265626704; Z-score: -0.961926298
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2D11     Adrenal cancer Click to Show/Hide
The Studied Tissue     Adrenal cortex
The Specified Disease     Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section     p-value: 0.072496278; Fold-change: -0.060282391; Z-score: -0.498079345
Target expression in the diseased tissue of patients
Target expression in tissue other than the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2D12     Endocrine gland neoplasm Click to Show/Hide
The Studied Tissue     Pituitary tissue
The Specified Disease     Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.45195212; Fold-change: -0.174198057; Z-score: -0.45669561
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Pituitary tissue
The Specified Disease     Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.52700937; Fold-change: 0.055294775; Z-score: 0.166052261
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2D42     Head and neck cancer Click to Show/Hide
The Studied Tissue     Head and neck tissue
The Specified Disease     Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.14E-59; Fold-change: -1.926293291; Z-score: -4.833796613
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 03 Disease of the blood or blood-forming organs Click to Show/Hide
                  ICD-11: 3A51     Sickle cell disorder Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.656843127; Fold-change: -0.040818275; Z-score: -0.230498874
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 3A70     Aplastic anaemia Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.110163602; Fold-change: 0.392033989; Z-score: 1.038478445
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 3B63     Thrombocytosis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.635886819; Fold-change: 0.004695851; Z-score: 0.042108939
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 3B64     Thrombocytopenia Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.733632114; Fold-change: 0.009145723; Z-score: 0.06608164
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 04 Disease of the immune system Click to Show/Hide
                  ICD-11: 4A00     Immunodeficiency Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.143822736; Fold-change: 0.011344045; Z-score: 0.134694642
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 4A40     Lupus erythematosus Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.027726981; Fold-change: -0.129520228; Z-score: -0.226044318
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 4A42     Systemic sclerosis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.110045395; Fold-change: 0.123205985; Z-score: 0.758792647
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 4A43     Systemic autoimmune disease Click to Show/Hide
The Studied Tissue     Salivary gland tissue
The Specified Disease     Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.495973598; Fold-change: -0.276771182; Z-score: -0.819590102
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.054463733; Fold-change: -0.577960195; Z-score: -1.741022713
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 4A62     Behcet disease Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.727785298; Fold-change: 0.032895012; Z-score: 0.276682858
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 4B04     Monocyte count disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.429481268; Fold-change: 0.033061419; Z-score: 0.322100805
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 05 Endocrine, nutritional or metabolic disease Click to Show/Hide
                  ICD-11: 5A11     Type 2 diabetes mellitus Click to Show/Hide
The Studied Tissue     Omental adipose tissue
The Specified Disease     Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.147656125; Fold-change: 0.081426856; Z-score: 0.764934725
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Liver tissue
The Specified Disease     Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.99860498; Fold-change: 0.053597832; Z-score: 0.294378463
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 5A80     Ovarian dysfunction Click to Show/Hide
The Studied Tissue     Vastus lateralis muscle
The Specified Disease     Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.856297499; Fold-change: 0.024585461; Z-score: 0.159907651
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 5B81     Obesity Click to Show/Hide
The Studied Tissue     Subcutaneous adipose tissue
The Specified Disease     Obesity [ICD-11:5B81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.764336138; Fold-change: 0.010150346; Z-score: 0.066854896
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 5C51     Inborn carbohydrate metabolism disorder Click to Show/Hide
The Studied Tissue     Biceps muscle
The Specified Disease     Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.456643947; Fold-change: 0.01365698; Z-score: 0.195100531
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 5C56     Lysosomal disease Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.582879611; Fold-change: 0.064394313; Z-score: 0.659349579
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 5C80     Hyperlipoproteinaemia Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.920022308; Fold-change: -0.065585535; Z-score: -0.376211607
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Whole blood
The Specified Disease     Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.003602117; Fold-change: -0.162457941; Z-score: -0.705348399
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 06 Mental, behavioural or neurodevelopmental disorder Click to Show/Hide
                  ICD-11: 6A02     Autism spectrum disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.408448482; Fold-change: 0.023612363; Z-score: 0.161440182
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 6A20     Schizophrenia Click to Show/Hide
The Studied Tissue     Superior temporal cortex
The Specified Disease     Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.342098525; Fold-change: -0.027346322; Z-score: -0.184797653
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Prefrontal cortex
The Specified Disease     Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.192678576; Fold-change: 0.054407734; Z-score: 0.209829714
                  ICD-11: 6A60     Bipolar disorder Click to Show/Hide
The Studied Tissue     Prefrontal cortex
The Specified Disease     Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.22125296; Fold-change: -0.058864914; Z-score: -0.444995967
                  ICD-11: 6A70     Depressive disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.832073249; Fold-change: 0.003645638; Z-score: 0.016086114
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Prefrontal cortex
The Specified Disease     Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.837813549; Fold-change: -0.043737127; Z-score: -0.361055857
      ICD Disease Classification 08 Disease of the nervous system Click to Show/Hide
                  ICD-11: 8A00     Parkinsonism Click to Show/Hide
The Studied Tissue     Substantia nigra tissue
The Specified Disease     Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.345060681; Fold-change: -0.113442467; Z-score: -0.692033163
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8A01     Choreiform disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.579633151; Fold-change: 0.004791489; Z-score: 0.046289674
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8A20     Alzheimer disease Click to Show/Hide
The Studied Tissue     Entorhinal cortex
The Specified Disease     Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.607238395; Fold-change: -0.015023251; Z-score: -0.096803658
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8A2Y     Neurocognitive impairment Click to Show/Hide
The Studied Tissue     White matter tissue
The Specified Disease     HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.1612911; Fold-change: -0.020868627; Z-score: -0.088526414
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8A40     Multiple sclerosis Click to Show/Hide
The Studied Tissue     Plasmacytoid dendritic cells
The Specified Disease     Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.959608312; Fold-change: -0.139930692; Z-score: -0.589395992
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Spinal cord
The Specified Disease     Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.245523959; Fold-change: -0.096468732; Z-score: -0.375537686
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8A60     Epilepsy Click to Show/Hide
The Studied Tissue     Peritumoral cortex tissue
The Specified Disease     Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section     p-value: 0.140473853; Fold-change: 0.334938053; Z-score: 2.605768759
Target expression in the diseased tissue of patients
Target expression in tissue other than the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Whole blood
The Specified Disease     Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.383408291; Fold-change: -0.061382993; Z-score: -0.54086295
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8B01     Subarachnoid haemorrhage Click to Show/Hide
The Studied Tissue     Intracranial artery
The Specified Disease     Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.453828538; Fold-change: 0.068399137; Z-score: 0.370401813
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8B11     Cerebral ischaemic stroke Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.089317168; Fold-change: 0.047137735; Z-score: 0.408265427
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Peripheral blood
The Specified Disease     Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.665285341; Fold-change: 0.077350945; Z-score: 0.513281381
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8B60     Motor neuron disease Click to Show/Hide
The Studied Tissue     Cervical spinal cord
The Specified Disease     Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.357938542; Fold-change: 0.059927654; Z-score: 0.485360842
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Skin
The Specified Disease     Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.744178476; Fold-change: -0.019457899; Z-score: -0.257295602
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8C70     Muscular dystrophy Click to Show/Hide
The Studied Tissue     Muscle tissue
The Specified Disease     Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.539061663; Fold-change: -0.081667053; Z-score: -0.57279298
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8C75     Distal myopathy Click to Show/Hide
The Studied Tissue     Muscle tissue
The Specified Disease     Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.001585627; Fold-change: -0.287386185; Z-score: -1.506257827
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 09 Disease of the visual system Click to Show/Hide
                  ICD-11: 9A96     Anterior uveitis Click to Show/Hide
The Studied Tissue     Peripheral monocyte
The Specified Disease     Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.018374981; Fold-change: -0.258557705; Z-score: -1.753155351
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 11 Disease of the circulatory system Click to Show/Hide
                  ICD-11: BA00     Essential hypertension Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Essential hypertension [ICD-11:BA00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.775362906; Fold-change: -0.044594943; Z-score: -0.459299354
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: BA41     Myocardial infarction Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.017128473; Fold-change: 0.44963131; Z-score: 0.804152323
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: BA80     Coronary artery disease Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.430967458; Fold-change: -0.114371174; Z-score: -0.413347424
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: BB70     Aortic valve stenosis Click to Show/Hide
The Studied Tissue     Calcified aortic valve
The Specified Disease     Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.764410171; Fold-change: -0.042310418; Z-score: -0.069845135
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 12 Disease of the respiratory system Click to Show/Hide
                  ICD-11: 7A40     Central sleep apnoea Click to Show/Hide
The Studied Tissue     Hyperplastic tonsil
The Specified Disease     Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.173377388; Fold-change: 1.01749281; Z-score: 1.634862331
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA08     Vasomotor or allergic rhinitis Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.053362125; Fold-change: 0.093663683; Z-score: 0.983416707
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA0A     Chronic rhinosinusitis Click to Show/Hide
The Studied Tissue     Sinus mucosa tissue
The Specified Disease     Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.094497083; Fold-change: -0.652519543; Z-score: -1.327690759
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA22     Chronic obstructive pulmonary disease Click to Show/Hide
The Studied Tissue     Lung tissue
The Specified Disease     Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.775330647; Fold-change: 0.023802818; Z-score: 0.048473068
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Small airway epithelium
The Specified Disease     Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.269257196; Fold-change: 0.038914857; Z-score: 0.109094037
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA23     Asthma Click to Show/Hide
The Studied Tissue     Nasal and bronchial airway
The Specified Disease     Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.000113997; Fold-change: 0.210403049; Z-score: 0.436518166
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CB03     Idiopathic interstitial pneumonitis Click to Show/Hide
The Studied Tissue     Lung tissue
The Specified Disease     Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.390788965; Fold-change: -0.347290471; Z-score: -1.068317725
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 13 Disease of the digestive system Click to Show/Hide
                  ICD-11: DA0C     Periodontal disease Click to Show/Hide
The Studied Tissue     Gingival tissue
The Specified Disease     Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 3.48E-10; Fold-change: 0.714594024; Z-score: 1.225162112
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: DA42     Gastritis Click to Show/Hide
The Studied Tissue     Gastric antrum tissue
The Specified Disease     Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.033490477; Fold-change: 1.101577521; Z-score: 5.035220252
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: DB92     Non-alcoholic fatty liver disease Click to Show/Hide
The Studied Tissue     Liver tissue
The Specified Disease     Non alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.003671906; Fold-change: 1.119433471; Z-score: 1.816040491
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: DB99     Hepatic failure Click to Show/Hide
The Studied Tissue     Liver tissue
The Specified Disease     Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.000135032; Fold-change: -0.56345365; Z-score: -2.259583236
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: DD71     Ulcerative colitis Click to Show/Hide
The Studied Tissue     Colon mucosal tissue
The Specified Disease     Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.146744868; Fold-change: 0.203029538; Z-score: 0.33621689
Target expression in the diseased tissue of patients
Target expression in tissue other than the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: DD91     Irritable bowel syndrome Click to Show/Hide
The Studied Tissue     Rectal colon tissue
The Specified Disease     Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.909318742; Fold-change: -0.04035881; Z-score: -0.086096052
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 14 Disease of the skin Click to Show/Hide
                  ICD-11: EA80     Atopic eczema Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.059789365; Fold-change: 0.060161849; Z-score: 0.312087839
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: EA90     Psoriasis Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.58E-23; Fold-change: -0.543040585; Z-score: -1.236051223
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 1.80E-11; Fold-change: 0.546861916; Z-score: 1.902479292
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: ED63     Acquired hypomelanotic disorder Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.306894325; Fold-change: 0.2039686; Z-score: 0.49298445
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: ED70     Alopecia or hair loss Click to Show/Hide
The Studied Tissue     Skin from scalp
The Specified Disease     Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.105482652; Fold-change: 0.131388528; Z-score: 0.490022595
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: EK0Z     Contact dermatitis Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.022882535; Fold-change: -0.321927954; Z-score: -1.222949937
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 15 Disease of the musculoskeletal system/connective tissue Click to Show/Hide
                  ICD-11: FA00     Osteoarthritis Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.152792516; Fold-change: 0.036036221; Z-score: 0.376612007
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Synovial tissue
The Specified Disease     Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.693254847; Fold-change: 0.116966579; Z-score: 0.877952047
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: FA20     Rheumatoid arthritis Click to Show/Hide
The Studied Tissue     Synovial tissue
The Specified Disease     Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.289616047; Fold-change: -0.110558123; Z-score: -0.434382104
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: FA24     Juvenile idiopathic arthritis Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.372140358; Fold-change: 0.058920302; Z-score: 0.305315482
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: FA92     Inflammatory spondyloarthritis Click to Show/Hide
The Studied Tissue     Pheripheral blood
The Specified Disease     Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.342815432; Fold-change: 0.00538521; Z-score: 0.050272117
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: FB83     Low bone mass disorder Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.036844161; Fold-change: 0.172853134; Z-score: 2.044306031
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 16 Disease of the genitourinary system Click to Show/Hide
                  ICD-11: GA10     Endometriosis Click to Show/Hide
The Studied Tissue     Endometrium tissue
The Specified Disease     Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.093279211; Fold-change: -0.149110245; Z-score: -0.377554001
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: GC00     Cystitis Click to Show/Hide
The Studied Tissue     Bladder tissue
The Specified Disease     Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.31E-05; Fold-change: -1.849844277; Z-score: -5.077902232
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 19 Certain condition originating in the perinatal period Click to Show/Hide
                  ICD-11: KA21     Short gestation disorder Click to Show/Hide
The Studied Tissue     Myometrium
The Specified Disease     Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.761099796; Fold-change: -0.00010128; Z-score: -0.000846526
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 20 Developmental anomaly Click to Show/Hide
                  ICD-11: LD2C     Overgrowth syndrome Click to Show/Hide
The Studied Tissue     Adipose tissue
The Specified Disease     Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.064059434; Fold-change: 0.055289716; Z-score: 1.536747149
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: LD2D     Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide
The Studied Tissue     Perituberal tissue
The Specified Disease     Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.015301149; Fold-change: 0.216949359; Z-score: 2.134995072
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
References
1 Coronaviruses - drug discovery and therapeutic options. Nat Rev Drug Discov. 2016 May;15(5):327-47.
2 SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell. 2020 Apr 16;181(2):271-280.e8.
3 ClinicalTrials.gov (NCT04353284) Camostat Mesylate in COVID-19 Outpatients

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.