Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T08910
(Former ID: TTDS00428)
|
|||||
Target Name |
GABA(A) receptor gamma-2 (GABRG2)
|
|||||
Synonyms |
Gamma-aminobutyric acid receptor subunit gamma-2; GABA(A) receptor subunit gamma-2
|
|||||
Gene Name |
GABRG2
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 3 Target-related Diseases | + | ||||
1 | Depression [ICD-11: 6A70-6A7Z] | |||||
2 | Mental/behavioural/neurodevelopmental disorder [ICD-11: 6E20-6E8Z] | |||||
3 | Tonus and reflex abnormality [ICD-11: MB47] | |||||
Function |
Plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel. The gamma2 subunit is necessary but not sufficient for a rapid formation of active synaptic contacts and the synaptogenic effect of this subunit is influenced by the type of alpha and beta subunits present in the receptor pentamer. The alpha1/beta2/gamma2 receptor and the alpha1/beta3/gamma2 receptor exhibit synaptogenic activity. The alpha2/beta2/gamma2 receptor exhibits synatogenic activity whereas the alpha2/beta3/gamma2 receptor shows very little or no synaptogenic activity. Functions also as histamine receptor and mediates cellular responses to histamine. Ligand-gated chloride channel which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain.
Click to Show/Hide
|
|||||
BioChemical Class |
Neurotransmitter receptor
|
|||||
UniProt ID | ||||||
Sequence |
MSSPNIWSTGSSVYSTPVFSQKMTVWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPK
VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQT WYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLY TLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQF SFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDA VPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFV SNRKPSKDKDKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCC FEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 2 Approved Drugs | + | ||||
1 | Allopregnanolone | Drug Info | Approved | Postpartum depression | [2], [3] | |
2 | THIOCOLCHICOSIDE | Drug Info | Approved | Muscle spasm | [4] | |
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | ZK-93423 | Drug Info | Phase 3 | Epileptic seizures | [5], [6] | |
2 | GSK683699 | Drug Info | Phase 2 | Inflammatory bowel disease | [7] | |
Discontinued Drug(s) | [+] 3 Discontinued Drugs | + | ||||
1 | ELTANOLONE | Drug Info | Discontinued in Phase 3 | Premenstrual syndrome | [8] | |
2 | U-78875 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [9] | |
3 | CGS-17867A | Drug Info | Terminated | Alcohol dependence | [10] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Inhibitor | [+] 116 Inhibitor drugs | + | ||||
1 | Allopregnanolone | Drug Info | [11] | |||
2 | THIOCOLCHICOSIDE | Drug Info | [1] | |||
3 | ZK-93423 | Drug Info | [12] | |||
4 | GSK683699 | Drug Info | [1] | |||
5 | ELTANOLONE | Drug Info | [11] | |||
6 | U-78875 | Drug Info | [13] | |||
7 | CGS-17867A | Drug Info | [14] | |||
8 | CGS-9896 | Drug Info | [15] | |||
9 | (2E,4S)-4-ammoniopent-2-enoate | Drug Info | [16] | |||
10 | (4R)-4-ammoniopentanoate | Drug Info | [16] | |||
11 | (4S)-4-ammoniopentanoate | Drug Info | [16] | |||
12 | (9-Benzyl-9H-purin-6-yl)-cyclopropyl-amine | Drug Info | [17] | |||
13 | (beta-CCE)9H-beta-Carboline-3-carboxylic acid | Drug Info | [18] | |||
14 | 1,1-Dimethyl-5-oxa-spiro[2.4]heptan-4-one | Drug Info | [19] | |||
15 | 1,3-Diphenyl-1H-chromeno[4,3-c]pyrazol-4-one | Drug Info | [20] | |||
16 | 1-(4-chlorophenyl)-4-phenyl-1H-imidazole | Drug Info | [15] | |||
17 | 1-Methyl-5-oxa-spiro[2.4]heptan-4-one | Drug Info | [19] | |||
18 | 2-(1H-Indol-3-yl)-2-oxo-N-phenethyl-acetamide | Drug Info | [18] | |||
19 | 2-(4-chlorophenyl)-5-phenyl-4-isoxazolin-3-one | Drug Info | [15] | |||
20 | 2-(9-Benzyl-9H-purin-6-ylamino)-ethanol | Drug Info | [17] | |||
21 | 2-Isoxazol-5-yl-3H-imidazo[4,5-c]quinoline | Drug Info | [21] | |||
22 | 2-Oxa-spiro[4.4]nonan-1-one | Drug Info | [19] | |||
23 | 2-Thiophen-2-yl-3H-imidazo[4,5-c]quinoline | Drug Info | [21] | |||
24 | 3,3-Diethyl-dihydro-furan-2-one | Drug Info | [19] | |||
25 | 3,3-Diisopropyl-dihydro-furan-2-one | Drug Info | [19] | |||
26 | 3-(3-Methyl-butoxy)-9H-beta-carboline | Drug Info | [22] | |||
27 | 3-(benzyloxy)-9H-pyrido[3,4-b]indole | Drug Info | [22] | |||
28 | 3-(hexa-1,3-dienyloxy)-9H-pyrido[3,4-b]indole | Drug Info | [22] | |||
29 | 3-amino-3-demethoxythiocolchicine | Drug Info | [1] | |||
30 | 3-Butoxy-9H-beta-carboline | Drug Info | [22] | |||
31 | 3-butoxycarbonyl-4-quinolone | Drug Info | [23] | |||
32 | 3-butoxycarbonyl-6-ethyl-4-quinolone | Drug Info | [23] | |||
33 | 3-butylaminocarbonyl-6-ethyl-4-quinolone | Drug Info | [23] | |||
34 | 3-carboxy-6-ethyl-4-quinolone | Drug Info | [23] | |||
35 | 3-cyclopentoxycarbonyl-6-ethyl-4-quinolone | Drug Info | [23] | |||
36 | 3-demethoxy-3-D-lyxopyranosylaminothiocolchicine | Drug Info | [1] | |||
37 | 3-demethoxy-3-D-mannopyranosylaminothiocolchicine | Drug Info | [1] | |||
38 | 3-demethoxy-3-D-xylopyranosylaminothiocolchicine | Drug Info | [1] | |||
39 | 3-demethoxy-3-L-fucopyranosylaminothiocolchicine | Drug Info | [1] | |||
40 | 3-demethoxy-3D-glucopyranosylaminothiocolchicine | Drug Info | [1] | |||
41 | 3-Ethoxy-9H-beta-carboline | Drug Info | [22], [24] | |||
42 | 3-ethoxycarbonyl-4-quinolone | Drug Info | [23] | |||
43 | 3-ethoxycarbonyl-6-ethyl-2-methyl-4-quinolone | Drug Info | [23] | |||
44 | 3-ethoxycarbonyl-6-propyl-4-quinolone | Drug Info | [23] | |||
45 | 3-Ethyl-3-isopropyl-dihydro-furan-2-one | Drug Info | [19] | |||
46 | 3-Ethyl-3-methyl-dihydro-furan-2-one | Drug Info | [19] | |||
47 | 3-Isobutoxy-9H-beta-carboline | Drug Info | [22] | |||
48 | 3-Isopropyl-3-methyl-dihydro-furan-2-one | Drug Info | [19] | |||
49 | 3-Isothiocyanato-9H-beta-carboline | Drug Info | [25] | |||
50 | 3-Methyl-1-phenyl-1H-chromeno[4,3-c]pyrazol-4-one | Drug Info | [20] | |||
51 | 3-Methyl-2-phenyl-2H-chromeno[4,3-c]pyrazol-4-one | Drug Info | [20] | |||
52 | 3-Methyl-9H-beta-carboline | Drug Info | [26] | |||
53 | 3-Propoxy-9H-beta-carboline | Drug Info | [22] | |||
54 | 3-tert-Butyl-3-ethyl-dihydro-furan-2-one | Drug Info | [19] | |||
55 | 4-(2-aminoethyl)-1,2,5-oxadiazol-3-ol | Drug Info | [27] | |||
56 | 4-(4-chlorophenyl)-1-pyrid-2-yl-pyrazole | Drug Info | [15] | |||
57 | 4-(biphenyl-3-yl)-5-(piperidin-4-yl)isoxazol-3-ol | Drug Info | [28] | |||
58 | 4-benzyl-5-(4-piperidyl)isothiazol-3-ol | Drug Info | [29] | |||
59 | 4-Benzyl-5-piperidin-4-yl-isoxazol-3-ol | Drug Info | [30] | |||
60 | 4-Methyl-5-(4-piperidyl)isothiazol-3-ol | Drug Info | [29] | |||
61 | 4-Naphthalen-1-yl-5-piperidin-4-yl-isoxazol-3-ol | Drug Info | [30] | |||
62 | 4-Naphthalen-2-yl-5-piperidin-4-yl-isoxazol-3-ol | Drug Info | [30] | |||
63 | 4-Phenyl-5-piperidin-4-yl-isoxazol-3-ol | Drug Info | [30] | |||
64 | 5-(4-piperidyl)-4-propylisothiazol-3-ol | Drug Info | [29] | |||
65 | 5-(piperidin-4-yl)isothiazol-3-ol | Drug Info | [29] | |||
66 | 5-(piperidin-4-yl)isoxazol-3-ol | Drug Info | [30] | |||
67 | 5-[(1R)-1-ammonioethyl]isoxazol-3-olate | Drug Info | [16] | |||
68 | 5-[(1S)-1-ammonioethyl]isoxazol-3-olate | Drug Info | [16] | |||
69 | 6,6-Dimethyl-2-oxa-spiro[4.4]nonan-1-one | Drug Info | [19] | |||
70 | 6,9-Dimethyl-2-oxa-spiro[4.4]nonan-1-one | Drug Info | [19] | |||
71 | 6-benzyl-3-ethoxycarbonyl-4-quinolone | Drug Info | [23] | |||
72 | 6-benzyl-3-propoxycarbonyl-4-quinolone | Drug Info | [23] | |||
73 | 6-benzyl-3-propylaminocarbonyl-4-quinolone | Drug Info | [23] | |||
74 | 6-bromo-3-ethoxycarbonyl-2-methyl-4-quinolone | Drug Info | [23] | |||
75 | 6-bromo-3-ethoxycarbonyl-4-quinolone | Drug Info | [23] | |||
76 | 6-ethyl-3-(2-ethylbutoxycarbonyl)-4-quinolone | Drug Info | [23] | |||
77 | 6-ethyl-3-(2-methylbutoxycarbonyl)-4-quinolone | Drug Info | [23] | |||
78 | 6-ethyl-3-(3-methylbutoxycarbonyl)-4-quinolone | Drug Info | [23] | |||
79 | 6-ethyl-3-(3-pentoxycarbonyl)-4-quinolone | Drug Info | [23] | |||
80 | 6-ethyl-3-i-propoxycarbonyl-4-quinolone | Drug Info | [23] | |||
81 | 6-ethyl-3-pentoxycarbonyl-4-quinolone | Drug Info | [23] | |||
82 | 6-ethyl-3-propoxycarbonyl-4-quinolone | Drug Info | [23] | |||
83 | 6-ethyl-3-propylaminocarbonyl-4-quinolone | Drug Info | [23] | |||
84 | 6-Methyl-2-oxa-spiro[4.4]nonan-1-one | Drug Info | [19] | |||
85 | 6-Nitro-2-(3-nitro-phenyl)-chromen-4-one | Drug Info | [31] | |||
86 | 6-Nitro-2-(4-nitro-phenyl)-chromen-4-one | Drug Info | [31] | |||
87 | 9H-beta-Carboline-3-carboxylic acid ethyl ester | Drug Info | [22], [32] | |||
88 | 9H-beta-Carboline-3-carboxylic acid propyl ester | Drug Info | [32] | |||
89 | AMENTOFLAVONE | Drug Info | [33] | |||
90 | Beta-Carboline-3-carboxylic acid t-butyl ester | Drug Info | [22] | |||
91 | BETA-CCM | Drug Info | [32] | |||
92 | CGS-13767 | Drug Info | [34] | |||
93 | CGS-9895 | Drug Info | [35] | |||
94 | CI-218872 | Drug Info | [26] | |||
95 | Ethyl 6-iodo-9H-pyrido[3,4-b]indole-3-carboxylate | Drug Info | [22] | |||
96 | GNF-PF-3645 | Drug Info | [23] | |||
97 | GNF-PF-4421 | Drug Info | [23] | |||
98 | L-655708 | Drug Info | [36] | |||
99 | N-(p-methylbenzyl)-5-nitroindol-3-ylglyoxylamide | Drug Info | [37] | |||
100 | N-Benzyl-2-(1H-indol-3-yl)-2-oxo-acetamide | Drug Info | [37] | |||
101 | N-benzyl-2-(5-nitro-1H-indol-3-yl)-2-oxoacetamide | Drug Info | [37] | |||
102 | N-butyl-2-(1H-indol-3-yl)-2-oxoacetamide | Drug Info | [37] | |||
103 | N-butyl-2-(5-nitro-1H-indol-3-yl)-2-oxoacetamide | Drug Info | [37] | |||
104 | N-Indan-1-yl-2-(1H-indol-3-yl)-2-oxo-acetamide | Drug Info | [38] | |||
105 | Ridine-5-carboxylic acid ethyl ester | Drug Info | [39] | |||
106 | RO-145974 | Drug Info | [40] | |||
107 | RO-145975 | Drug Info | [40] | |||
108 | RO-147437 | Drug Info | [40] | |||
109 | Ro-15-3505 | Drug Info | [40] | |||
110 | RO-194603 | Drug Info | [40] | |||
111 | Ro-4938581 | Drug Info | [41] | |||
112 | RY-066 | Drug Info | [42] | |||
113 | Sec-butyl 9H-pyrido[3,4-b]indole-3-carboxylate | Drug Info | [22] | |||
114 | U-89267 | Drug Info | [44] | |||
115 | [3H]CGS8216 | Drug Info | [34] | |||
116 | [3H]Ro154513 | Drug Info | [44] | |||
Blocker (channel blocker) | [+] 1 Blocker (channel blocker) drugs | + | ||||
1 | TBPS | Drug Info | [43] |
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 5 KEGG Pathways | + | ||||
1 | Neuroactive ligand-receptor interaction | |||||
2 | Retrograde endocannabinoid signaling | |||||
3 | GABAergic synapse | |||||
4 | Morphine addiction | |||||
5 | Nicotine addiction | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Ligand-gated ion channel transport | |||||
2 | GABA A receptor activation | |||||
WikiPathways | [+] 2 WikiPathways | + | ||||
1 | Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | |||||
2 | Iron uptake and transport |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | 3-demethoxy-3-glycosylaminothiocolchicines: Synthesis of a new class of putative muscle relaxant compounds. J Med Chem. 2006 Sep 7;49(18):5571-7. | |||||
REF 2 | Antibodies and venom peptides: new modalities for ion channels. Nat Rev Drug Discov. 2019 May;18(5):339-357. | |||||
REF 3 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 4 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4346). | |||||
REF 6 | Abecarnil enhances GABA-induced currents in acutely isolated cerebellar Purkinje cells. Neuropharmacology. 1995 Feb;34(2):157-63. | |||||
REF 7 | Emerging drugs to treat Crohn's disease. Expert Opin Emerg Drugs. 2007 Mar;12(1):49-59. | |||||
REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005875) | |||||
REF 9 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001194) | |||||
REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000696) | |||||
REF 11 | Neurosteroid analogues. 10. The effect of methyl group substitution at the C-6 and C-7 positions on the GABA modulatory and anesthetic actions of (... J Med Chem. 2005 Apr 21;48(8):3051-9. | |||||
REF 12 | Structural requirements for agonist actions at the benzodiazepine receptor: studies with analogues of 6-(benzyloxy)-4-(methoxymethyl)-beta-carbolin... J Med Chem. 1990 Mar;33(3):1062-9. | |||||
REF 13 | 3-Phenyl-substituted imidazo[1,5-alpha]quinoxalin-4-ones and imidazo[1,5-alpha]quinoxaline ureas that have high affinity at the GABAA/benzodiazepin... J Med Chem. 1996 Sep 13;39(19):3820-36. | |||||
REF 14 | 2,5-Dihydropyrazolo[4,3-c]pyridin-3-ones: functionally selective benzodiazepine binding site ligands on the GABAA receptor. Bioorg Med Chem Lett. 2004 Jul 5;14(13):3441-4. | |||||
REF 15 | Synthesis, pharmacology, and structure-activity relationships of novel imidazolones and pyrrolones as modulators of GABAA receptors. J Med Chem. 2006 Mar 23;49(6):1855-66. | |||||
REF 16 | gamma-Aminobutyric acid agonists, antagonists, and uptake inhibitors. Design and therapeutic aspects. J Med Chem. 1981 Dec;24(12):1377-83. | |||||
REF 17 | Benzodiazepine receptor binding activity of 6,9-disubstituted purines. J Med Chem. 1989 May;32(5):1020-4. | |||||
REF 18 | Benzodiazepine receptor affinity and interaction of some N-(indol-3-ylglyoxylyl)amine derivatives. J Med Chem. 1992 Jun 12;35(12):2214-20. | |||||
REF 19 | Alpha-spirocyclopentyl- and alpha-spirocyclopropyl-gamma-butyrolactones: conformationally constrained derivatives of anticonvulsant and convulsant ... J Med Chem. 1994 Jan 21;37(2):275-86. | |||||
REF 20 | Synthesis, binding studies, and structure-activity relationships of 1-aryl-and 2-aryl[1]benzopyranopyrazol-4-ones, central benzodiazepine receptor ... J Med Chem. 1988 Jan;31(1):1-3. | |||||
REF 21 | Synthesis and structure--activity relationships of fused imidazopyridines: a new series of benzodiazepine receptor ligands. J Med Chem. 1996 Jul 5;39(14):2844-51. | |||||
REF 22 | Design, synthesis, and subtype selectivity of 3,6-disubstituted -carbolines at Bz/GABA(A)ergic receptors. SAR and studies directed toward agents f... Bioorg Med Chem. 2010 Nov 1;18(21):7548-64. | |||||
REF 23 | 4-quinolone derivatives: high-affinity ligands at the benzodiazepine site of brain GABA A receptors. synthesis, pharmacology, and pharmacophore mod... J Med Chem. 2006 Apr 20;49(8):2526-33. | |||||
REF 24 | Synthesis and evaluation of analogues of the partial agonist 6-(propyloxy)-4-(methoxymethyl)-beta-carboline-3-carboxylic acid ethyl ester (6-PBC) a... J Med Chem. 1998 Jul 2;41(14):2537-52. | |||||
REF 25 | Synthetic and computer-assisted analyses of the pharmacophore for the benzodiazepine receptor inverse agonist site. J Med Chem. 1990 Sep;33(9):2343-57. | |||||
REF 26 | Four amino acid exchanges convert a diazepam-insensitive, inverse agonist-preferring GABAA receptor into a diazepam-preferring GABAA receptor. J Med Chem. 1994 Dec 23;37(26):4576-80. | |||||
REF 27 | Hydroxy-1,2,5-oxadiazolyl moiety as bioisoster of the carboxy function. Synthesis, ionization constants, and pharmacological characterization of ga... J Med Chem. 2006 Jul 13;49(14):4442-6. | |||||
REF 28 | Novel 4-(piperidin-4-yl)-1-hydroxypyrazoles as gamma-aminobutyric acid(A) receptor ligands: synthesis, pharmacology, and structure-activity relatio... J Med Chem. 2010 Apr 22;53(8):3417-21. | |||||
REF 29 | Potent 4-arylalkyl-substituted 3-isothiazolol GABA(A) competitive/noncompetitive antagonists: synthesis and pharmacology. J Med Chem. 2006 Feb 23;49(4):1388-96. | |||||
REF 30 | Potent 4-aryl- or 4-arylalkyl-substituted 3-isoxazolol GABA(A) antagonists: synthesis, pharmacology, and molecular modeling. J Med Chem. 2005 Jan 27;48(2):427-39. | |||||
REF 31 | 6,3'-Dinitroflavone, a novel high affinity ligand for the benzodiazepine receptor with potent anxiolytic properties, Bioorg. Med. Chem. Lett. 5(22):2717-2720 (1995). | |||||
REF 32 | beta-Carbolines as benzodiazepine receptor ligands. 1. Synthesis and benzodiazepine receptor interaction of esters of beta-carboline-3-carboxylic a... J Med Chem. 1983 Apr;26(4):499-503. | |||||
REF 33 | Semisynthetic preparation of amentoflavone: A negative modulator at GABA(A) receptors. Bioorg Med Chem Lett. 2003 Jul 21;13(14):2281-4. | |||||
REF 34 | Synthesis and benzodiazepine binding activity of a series of novel [1,2,4]triazolo[1,5-c]quinazolin-5(6H)-ones. J Med Chem. 1991 Jan;34(1):281-90. | |||||
REF 35 | 1,3-Diarylpyrazolo[4,5-c]- and -[5,4-c]quinolin-4-ones. 4. Synthesis and specific inhibition of benzodiazepine receptor binding. J Med Chem. 1987 Oct;30(10):1737-42. | |||||
REF 36 | 3-phenyl-6-(2-pyridyl)methyloxy-1,2,4-triazolo[3,4-a]phthalazines and analogues: high-affinity gamma-aminobutyric acid-A benzodiazepine receptor li... J Med Chem. 2004 Mar 25;47(7):1807-22. | |||||
REF 37 | Novel N-substituted indol-3-ylglyoxylamides probing the LDi and L1/L2 lipophilic regions of the benzodiazepine receptor site in search for subtype-... J Med Chem. 2007 Apr 5;50(7):1627-34. | |||||
REF 38 | Novel N-(arylalkyl)indol-3-ylglyoxylylamides targeted as ligands of the benzodiazepine receptor: synthesis, biological evaluation, and molecular mo... J Med Chem. 2001 Jul 5;44(14):2286-97. | |||||
REF 39 | Synthesis and structure-activity relationships of a series of anxioselective pyrazolopyridine ester and amide anxiolytic agents. J Med Chem. 1989 Dec;32(12):2561-73. | |||||
REF 40 | Synthesis and evaluation of imidazo[1,5-a][1,4]benzodiazepine esters with high affinities and selectivities at "diazepam-insensitive" benzodiazepin... J Med Chem. 1993 Apr 16;36(8):1001-6. | |||||
REF 41 | The discovery and unique pharmacological profile of RO4938581 and RO4882224 as potent and selective GABAA alpha5 inverse agonists for the treatment... Bioorg Med Chem Lett. 2009 Oct 15;19(20):5940-4. | |||||
REF 42 | Predictive models for GABAA/benzodiazepine receptor subtypes: studies of quantitative structure-activity relationships for imidazobenzodiazepines a... J Med Chem. 1998 Oct 8;41(21):4130-42. | |||||
REF 43 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 414). | |||||
REF 44 | Antagonist, partial agonist, and full agonist imidazo[1,5-a]quinoxaline amides and carbamates acting through the GABAA/benzodiazepine receptor. J Med Chem. 1994 Mar 18;37(6):758-68. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.