Target General Infomation
Target ID
T66426 (Former ID: TTDI02038)
Target Name
Hematopoietic progenitor cell antigen CD34 (CD34)
Synonyms
CD34 molecule
Gene Name
CD34
Target Type
Clinical trial target
[1]
Disease [+] 3 Target-related Diseases +
1 Heart failure [ICD-11: BD10-BD1Z]
2 Acute myeloid leukaemia [ICD-11: 2A60]
3 Myelodysplastic syndrome [ICD-11: 2A37]
Function
Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins. Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells.
UniProt ID
CD34_HUMAN
Sequence
MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQE
TTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTV
FTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGI
REVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRP
QCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGAL
LAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQ
ENGTGQATSRNGHSARQHVVADTEL
Drugs and Modes of Action
Clinical Trial Drug(s) [+] 2 Clinical Trial Drugs +
1 AMR-001 Drug Info Phase 2 Heart failure [2]
2 CART-34 cells Drug Info Phase 1 Myelodysplastic syndrome [3]
Preclinical Drug(s) [+] 1 Preclinical Drugs +
1 CAR-T cells targeting CD34 Drug Info Preclinical Acute myeloid leukaemia [4]
Mode of Action [+] 2 Modes of Action +
Modulator [+] 1 Modulator drugs +
1 AMR-001 Drug Info [1]
CAR-T-Cell-Therapy [+] 2 CAR-T-Cell-Therapy drugs +
1 CART-34 cells Drug Info [3]
2 CAR-T cells targeting CD34 Drug Info [4]
Target Regulators
Target-regulating microRNAs
Target-regulating Transcription Factors
Target Affiliated Biological Pathways
NetPath Pathway [+] 1 NetPath Pathways +
1 TGF_beta_Receptor Signaling Pathway
PID Pathway [+] 1 PID Pathways +
1 C-MYB transcription factor network
WikiPathways [+] 2 WikiPathways +
1 Hematopoietic Stem Cell Differentiation
2 Hair Follicle Development: Cytodifferentiation (Part 3 of 3)
References
REF 1 National Cancer Institute Drug Dictionary (drug id 743421).
REF 2 ClinicalTrials.gov (NCT01495364) NBS10 (Also Known as AMR-001) Versus Placebo Post ST Segment Elevation Myocardial Infarction. U.S. National Institutes of Health.
REF 3 ClinicalTrials.gov (NCT03291444) CAR-T Cells Combined With Peptide Specific Dendritic Cell in Relapsed/Refractory Leukemia/MDS
REF 4 ClinicalTrials.gov (NCT03473457) CAR-T Cells Therapy in Relapsed/Refractory Acute Myeloid Leukemia

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.