Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T35486
|
||||
| Former ID |
TTDI01767
|
||||
| Target Name |
Ras GTPase
|
||||
| Gene Name |
NRAS
|
||||
| Synonyms |
NRAS
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
| Colorectal cancer; Pancreatic cancer [ICD9: 153, 154, 157; ICD10: C18-C21, C25] | |||||
| Fallopian tube cancer; Metastatic head and neck cancer [ICD9:140-149, 140-199, 140-229, 183, 210-229; ICD10: C57.0, D28.2, C07-C14, C32-C33] | |||||
| Lung adenocarcinomas [ICD10: C33-C34] | |||||
| Prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Function |
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
|
||||
| BioChemical Class |
Ras family
|
||||
| UniProt ID | |||||
| Sequence |
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | GI-4000 | Drug Info | Phase 2 | Colorectal cancer; Pancreatic cancer | [522284] |
| Mutant ras vaccine | Drug Info | Phase 2 | Cancer | [549715] | |
| Reovirus | Drug Info | Phase 2 | Fallopian tube cancer; Metastatic head and neck cancer | [523165] | |
| Salirasib | Drug Info | Phase 2 | Lung adenocarcinomas | [541433], [548607] | |
| Perillyl alcohol | Drug Info | Discontinued in Phase 2 | Cancer | [545708] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| DRM | DRM Info | ||||
| Pathways | |||||
| PathWhiz Pathway | Intracellular Signalling Through Adenosine Receptor A2a and Adenosine | ||||
| Intracellular Signalling Through Adenosine Receptor A2b and Adenosine | |||||
| Fc Epsilon Receptor I Signaling in Mast Cells | |||||
| Insulin Signalling | |||||
| Reactome | SOS-mediated signalling | ||||
| Activation of RAS in B cells | |||||
| Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants | |||||
| SHC1 events in ERBB2 signaling | |||||
| SHC1 events in ERBB4 signaling | |||||
| p38MAPK events | |||||
| GRB2 events in EGFR signaling | |||||
| SHC1 events in EGFR signaling | |||||
| GRB2 events in ERBB2 signaling | |||||
| Tie2 Signaling | |||||
| EGFR Transactivation by Gastrin | |||||
| DAP12 signaling | |||||
| SHC-related events triggered by IGF1R | |||||
| FCERI mediated MAPK activation | |||||
| NCAM signaling for neurite out-growth | |||||
| EPHB-mediated forward signaling | |||||
| VEGFR2 mediated cell proliferation | |||||
| CD209 (DC-SIGN) signaling | |||||
| Constitutive Signaling by EGFRvIII | |||||
| FGFR1 | |||||
| FRS-mediated FGFR1 signaling | |||||
| FGFR2 | |||||
| FRS-mediated FGFR2 signaling | |||||
| FGFR3 | |||||
| FRS-mediated FGFR3 signaling | |||||
| FRS-mediated FGFR4 signaling | |||||
| FGFR4 | |||||
| Regulation of RAS by GAPs | |||||
| RAF activation | |||||
| RAF/MAP kinase cascade | |||||
| MAP2K and MAPK activation | |||||
| Negative regulation of MAPK pathway | |||||
| Insulin receptor signalling cascade | |||||
| WikiPathways | Serotonin Receptor 2 and ELK-SRF/GATA4 signaling | ||||
| DNA Damage Response (only ATM dependent) | |||||
| TCR Signaling Pathway | |||||
| ErbB Signaling Pathway | |||||
| Senescence and Autophagy in Cancer | |||||
| TGF Beta Signaling Pathway | |||||
| IL-2 Signaling Pathway | |||||
| Insulin Signaling | |||||
| EGF/EGFR Signaling Pathway | |||||
| MAPK Cascade | |||||
| p38 MAPK Signaling Pathway | |||||
| G Protein Signaling Pathways | |||||
| Signaling of Hepatocyte Growth Factor Receptor | |||||
| Kit receptor signaling pathway | |||||
| Extracellular vesicle-mediated signaling in recipient cells | |||||
| IL-3 Signaling Pathway | |||||
| Bladder Cancer | |||||
| Signaling by ERBB4 | |||||
| Signaling by ERBB2 | |||||
| Fc epsilon receptor (FCERI) signaling | |||||
| Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | |||||
| Signaling by the B Cell Receptor (BCR) | |||||
| RAF/MAP kinase cascade | |||||
| Interleukin-2 signaling | |||||
| Signaling by SCF-KIT | |||||
| DAP12 interactions | |||||
| Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R) | |||||
| Gastrin-CREB signalling pathway via PKC and MAPK | |||||
| Nanoparticle-mediated activation of receptor signaling | |||||
| JAK/STAT | |||||
| Aryl Hydrocarbon Receptor | |||||
| PDGF Pathway | |||||
| Alpha 6 Beta 4 signaling pathway | |||||
| BDNF signaling pathway | |||||
| Oncostatin M Signaling Pathway | |||||
| Interleukin-11 Signaling Pathway | |||||
| TNF alpha Signaling Pathway | |||||
| B Cell Receptor Signaling Pathway | |||||
| RalA downstream regulated genes | |||||
| Prostate Cancer | |||||
| Signaling Pathways in Glioblastoma | |||||
| Leptin signaling pathway | |||||
| TSH signaling pathway | |||||
| Signaling by PDGF | |||||
| Signaling by Insulin receptor | |||||
| Signaling by FGFR | |||||
| Signaling by EGFR | |||||
| NGF signalling via TRKA from the plasma membrane | |||||
| NCAM signaling for neurite out-growth | |||||
| Integrin-mediated Cell Adhesion | |||||
| Interleukin-3, 5 and GM-CSF signaling | |||||
| Cell surface interactions at the vascular wall | |||||
| References | |||||
| Ref 522284 | ClinicalTrials.gov (NCT00655161) A Pilot Phase 2 Trial of the Immunogenicity, and Safety of GI-4000; an Inactivated Recombinant S. Cerevisiae Expressing Mutant Ras Protein, as Consolidation Therapy Following Curative Treatment for Stage I-III Non-Small Cell Lung Cancer (NSCLC) With Tumor Sequence Confirmation of K-ras Mutation. U.S. National Institutes of Health. | ||||
| Ref 523165 | ClinicalTrials.gov (NCT01199263) Paclitaxel With or Without Viral Therapy in Treating Patients With Recurrent or Persistent Ovarian Epithelial, Fallopian Tube, or Primary Peritoneal Cancer. U.S. National Institutes of Health. | ||||
| Ref 541433 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6281). | ||||
| Ref 545708 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004297) | ||||
| Ref 529397 | The Ras inhibitor farnesylthiosalicylic acid (Salirasib) disrupts the spatiotemporal localization of active Ras: a potential treatment for cancer. Methods Enzymol. 2008;439:467-89. | ||||
| Ref 532684 | The immunological and clinical effects of mutated ras peptide vaccine in combination with IL-2, GM-CSF, or both in patients with solid tumors. J Transl Med. 2014 Feb 24;12:55. | ||||
| Ref 532891 | Phase II study of the GI-4000 KRAS vaccine after curative therapy in patients with stage I-III lung adenocarcinoma harboring a KRAS G12C, G12D, or G12V mutation. Clin Lung Cancer. 2014 Nov;15(6):405-10. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.