Target Information

Target General Infomation
Target ID
T72657
Former ID
TTDS00219
Target Name
30S ribosomal subunit
Gene Name
pbp2
Synonyms
30S ribosome subunit; pbp2
Target Type
Successful
Disease Acne vulgaris [ICD9: 706.1; ICD10: L70.0]
Acute and chronic intestinal amebiasis [ICD9: 6; ICD10: A06]
Acute hepatic failure; Alcoholic cirrhosis of liver [ICD9: 570, 571.1; ICD10: K71, K72]
Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99]
Lyme disease; Acne; Bronchitis [ICD10: L70, J20-J21, J42]
Skin infections [ICD9: 680-709; ICD10: L00-L99]
Target Validation
T72657
UniProt ID
F4NA87
Sequence
MTENKGSSQPKKNGNNGGKSNSKKNRNVKRTIIKIIGFMIIAFFVVLLLGILLFAYYAWK
APAFTEAKLQDPIPAKIYDKNGELVKTLDNGQRHEHVNLKDVPKSMKDAVLATEDNRFYE
HGALDYKRLFGAIGKNLTGGFGSEGASTLTQQVVKDAFLSQHKSIGRKAQEAYLSYRLEQ
EYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLPQVPNNYNIY
DHPKAAEDRKNTVLYLMHYHKRITDKQWEDAKKIDLKANLVNRTAEERQNIDTNQDSEYN
SYVNFVKSELMNNKAFKDENLGNVLQSGIKIYTNMDKDVQKTLQNDVDNGSFYKNKDQQV
GATILDSKTGGLVAISGGRDFKDVVNRNQATDPHPTGSSLKPFLAYGPAIENMKWATNHA
IQDESSYQVDGSTFRNYDVKSHGTVSIYDALRQSFNIPALKAWQSVKQNAGNDAPKKFAA
KLGLNYEGDIGPSEVLGGSASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRDGETIEY
DHTSHKAMSDYTAYMLAEMLKGTFKPYGSAYGHGVSGVNMGAKTGTGTYGAETYSQYNLP
DNAAKDVWINGFTPQYTMSVWMGFSKVKQYGENSFVGHSQQEYPQFLYENVMSKISSRDG
EDFKRPSSVSGSIPSINVSGSQDNNTTNRSTHGGSDTSANSSGTAQSNNNTRSQQSRNSG
GLTGIFN
Drugs and Mode of Action
Drug(s) Amikacin Drug Info Approved Bacterial infections [536094]
Clomocycline Drug Info Approved Bacterial infections [536600]
Demeclocycline Drug Info Approved Lyme disease; Acne; Bronchitis [551871]
Framycetin Drug Info Approved Bacterial infections [550693]
Kanamycin Drug Info Approved Bacterial infections [536472]
Lymecycline Drug Info Approved Bacterial infections [550671]
Meclocycline Drug Info Approved Bacterial infections [538215]
Methacycline Drug Info Approved Bacterial infections [550755]
Minocycline Drug Info Approved Bacterial infections [536447]
Neomycin Drug Info Approved Acute hepatic failure; Alcoholic cirrhosis of liver [538196], [542095]
Netilmicin Drug Info Approved Bacterial infections [536361]
Oxytetracycline Drug Info Approved Bacterial infections [538197]
Paromomycin Drug Info Approved Acute and chronic intestinal amebiasis [538211]
Rolitetracycline Drug Info Approved Acne vulgaris [536718], [551871]
Spectinomycin Drug Info Approved Bacterial infections [538593]
Streptomycin Drug Info Approved Bacterial infections [536838]
Tetracycline Drug Info Approved Bacterial infections [536773]
Tigecycline Drug Info Approved Skin infections [528128], [536254], [551186]
Binder Amikacin Drug Info [534968]
Clomocycline Drug Info [536600]
Demeclocycline Drug Info [535969]
Framycetin Drug Info [535064]
Kanamycin Drug Info [535490]
Lymecycline Drug Info [536284]
Meclocycline Drug Info [535969]
Methacycline Drug Info [536603]
Minocycline Drug Info [536233]
Neomycin Drug Info [536559]
Netilmicin Drug Info [537813]
Oxytetracycline Drug Info [535969]
Paromomycin Drug Info [535431], [537314]
Rolitetracycline Drug Info [536718]
Spectinomycin Drug Info [535052]
Streptomycin Drug Info [535052], [536345]
Tetracycline Drug Info [535890]
Tigecycline Drug Info [536254]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
DRM DRM Info
References
Ref 528128Tigecycline (Tygacil): the first in the glycylcycline class of antibiotics. Proc (Bayl Univ Med Cent). 2006 Apr;19(2):155-61.
Ref 536094Emerging drugs for bacterial urinary tract infections. Expert Opin Emerg Drugs. 2005 May;10(2):275-98.
Ref 536254Tigecycline: first of a new class of antimicrobial agents. Pharmacotherapy. 2006 Aug;26(8):1099-110.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 536447Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52.
Ref 536472Novel agents in the management of Mycobacterium tuberculosis disease. Curr Med Chem. 2007;14(18):2000-8.
Ref 536600Molecular dynamics simulations of the 30S ribosomal subunit reveal a preferred tetracycline binding site. J Am Chem Soc. 2008 Jan 30;130(4):1114-5.
Ref 536718Reversed-phase high-performance liquid chromatography coupled to ultraviolet and electrospray time-of-flight mass spectrometry on-line detection for the separation of eight tetracyclines in honey samples. J Chromatogr A. 2008 Jun 27;1195(1-2):107-16. Epub 2008 May 10.
Ref 536773How many modes of action should an antibiotic have? Curr Opin Pharmacol. 2008 Oct;8(5):564-73. Epub 2008 Jul 30.
Ref 536838Emerging drugs for chemotherapy-induced mucositis. Expert Opin Emerg Drugs. 2008 Sep;13(3):511-22.
Ref 538196FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 060304.
Ref 538197FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 060634.
Ref 538211FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 064171.
Ref 538215FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 065094.
Ref 538593FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 050347.
Ref 542095(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 709).
Ref 550671Drug information of Lymecycline, 2008. eduDrugs.
Ref 550693Drug information of Framycetin, 2008. eduDrugs.
Ref 550755Drug information of Methacycline, 2008. eduDrugs.
Ref 5511862005 approvals: Safety first. Nature Reviews Drug Discovery 5, 92-93 (February 2006).
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 534968Bacterial resistance to aminoglycosides and beta-lactams: the Tn1331 transposon paradigm. Front Biosci. 2000 Jan 1;5:D20-9.
Ref 535052Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics. Nature. 2000 Sep 21;407(6802):340-8.
Ref 535064Antistaphylococcal activity of gentamicin. Minerva Med. 1975 Dec 8;66(84):4505-26.
Ref 53543130S ribosomal subunit assembly is a target for inhibition by aminoglycosides in Escherichia coli. Antimicrob Agents Chemother. 2002 May;46(5):1546-9.
Ref 535490SsrA-mediated protein tagging in the presence of miscoding drugs and its physiological role in Escherichia coli. Genes Cells. 2002 Jul;7(7):629-38.
Ref 535890The glycylcyclines: a comparative review with the tetracyclines. Drugs. 2004;64(1):63-88.
Ref 535969Detection of tetracycline resistance genes by PCR methods. Methods Mol Biol. 2004;268:3-13.
Ref 536233Functional, biophysical, and structural bases for antibacterial activity of tigecycline. Antimicrob Agents Chemother. 2006 Jun;50(6):2156-66.
Ref 536254Tigecycline: first of a new class of antimicrobial agents. Pharmacotherapy. 2006 Aug;26(8):1099-110.
Ref 536284Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34.
Ref 536345The interaction between streptomycin and ribosomal RNA. Biochimie. 1991 Dec;73(12):1431-8.
Ref 536559Characterization of a 30S ribosomal subunit assembly intermediate found in Escherichia coli cells growing with neomycin or paromomycin. Arch Microbiol. 2008 May;189(5):441-9. Epub 2007 Dec 5.
Ref 536600Molecular dynamics simulations of the 30S ribosomal subunit reveal a preferred tetracycline binding site. J Am Chem Soc. 2008 Jan 30;130(4):1114-5.
Ref 536603Tetracyclines and pulmonary inflammation. Endocr Metab Immune Disord Drug Targets. 2007 Dec;7(4):232-6.
Ref 536718Reversed-phase high-performance liquid chromatography coupled to ultraviolet and electrospray time-of-flight mass spectrometry on-line detection for the separation of eight tetracyclines in honey samples. J Chromatogr A. 2008 Jun 27;1195(1-2):107-16. Epub 2008 May 10.
Ref 537314Aminoglycoside association pathways with the 30S ribosomal subunit. J Phys Chem B. 2009 May 21;113(20):7322-30.
Ref 537813Ribosomal resistance in the gentamicin producer organism Micromonospora purpurea. Antimicrob Agents Chemother. 1982 Aug;22(2):231-6.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.