Resistance mutation info of drug
Drug General Information | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
Drug ID | D0E3OF | ||||||||||
Drug Name | Warfarin | ||||||||||
Synonyms | Brumolin; Choice; Coumadin; Coumafen; Coumafene; Coumaphen; Coumaphene; Coumarins; Coumefene; Dethmor; Dethnel; Kumader; Kumadu; Kumatox; Kypfarin; Maveran; Panwarfin; Prothromadin; RAX; Ratorex; Ratoxin; Ratron; Rattentraenke; Rattunal; Rodafarin; Rosex; Sofarin; Solfarin; Warfarat; Warfarina; Warfarine; Warfarinum; Warficide; Zoocoumarin; Arab Rat Death; Arab rat deth; Coumafene [French]; Dicusat E; Eastern states duocide; Fasco fascrat powder; Maag Rattentod Cum; Mouse pak; Ratron G; Rattenstreupulver Neu Schacht; Rattenstreupulver new schacht; Rodafarin C; Rodex blox; Sorexa plus; Temus W; Twin light rat away; Vampirinip II; Vampirinip iii; Warfarin Q; Warfarin plus; Warfarin plus [discontinued]; Zoocoumarin [Netherlands and USSR]; Zoocoumarin [Russian]; CBKinase1_000192; CBKinase1_012592; Latka 42; Latka 42 [Czech]; PS104_SUPELCO; WARF compound 42; Warf 10; Warf 42; Athrombine-K; CO-Rax; Choice (TN); Coumadin (TN); D-Con; Frass-Ratron; Jantoven (TN); Liqua-tox; Mar-Frin; Marevan (TN); Place-pax; Rac-Warfarin; Rat & mice bait; Rat-Gard; Rat-Kill; Rat-Mix; Rat-Ola; Rat-Trol; Ratten-Koederrohr; Ro-Deth; Rough & ready mouse mix; Tox-hid; Waran (TN); Warfarin (INN); Warfarin (and salts of); Warfarin [BSI:ISO]; Warfarin [INN:BAN]; Warfarin(R); Warfarina [INN-Spanish]; Warfarine [INN-French]; Warfarine [ISO-French]; Warfarinum [INN-Latin]; Cov-R-Tox; Martin's mar-frin; Rat-B-gon; Rat-a-way; Rats-no-more; Spray-trol brand roden-trol; Rat-o-cide #2; Warfarin titrated to an INR of 2.5-3.0; W.A.R.F. 42; (-)-Warfarin; (S)-Warfarin; 200 coumarin | ||||||||||
Drug Type | Small molecular drug | ||||||||||
Therapeutic Class | Anticoagulants | ||||||||||
Company | Pharmaceutical Research Assoc Inc | ||||||||||
Structure |
![]() |
||||||||||
Drug Resistance Mutations | |||||||||||
Target Name | Vitamin K epoxide reductase complex subunit 1 (VKORC1) | Target Info | |||||||||
Gene Name | VKORC1 | ||||||||||
Uniprot ID | VKOR1_HUMAN | ||||||||||
Species | Homo sapiens | ||||||||||
Reference Sequence |
MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWG RGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYL AWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH [Homo sapiens] |
||||||||||
Targeted Disease | Blood clot | ||||||||||
Drug Resistance Mutations |
|
||||||||||
References | |||||||||||
REF 1 | VKORC1 V66M mutation in African Brazilian patients resistant to oral anticoagulant therapy.Thromb Res.2010 Sep;126(3):e206-10. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.