| Drug General Information |
| Drug ID |
D0N0EQ
|
| Drug Name |
Streptomycin |
|
| Synonyms |
Agrept; Agrimycin; Gerox; Neodiestreptopab; SRY; Strepcen; Streptomicina; Streptomycine; Streptomycinum; Streptomyzin; Liposomal Streptomycin; Streptomicina [Italian]; Streptomycin A; Streptomycin A sulfate; Streptomycin Sesquisulfate Hydrate; Streptomycin sulfate; Streptomycin sulphate; Streptomyzin [German]; Agrept (TN); Estreptomicina [INN-Spanish]; Hokko-mycin; Plantomycin (TN); Rimosidin (TN); Streptomycin & EEP; Streptomycin & Propolis; Streptomycin (INN); Streptomycin (TN); Streptomycin [INN:BAN]; Streptomycin, Sulfate Salt; AS-50 (TN); STREPTOMYCIN SULFATE (2:3) SALT; Agri-mycin-17 (TN); O-2-Deoxy-2-(methylamino)-.alpha.-L-glucopyranosyl-(1->2)-O-5-deoxy-3-C-formyl-.alpha.-L-lyxofuranosyl-(1->4)-N,N'-bis(aminoiminomethyl)-D-streptamine and Liposome; N,N'''-[(1R,2R,3S,4R,5R,6S)-4-{5-deoxy-2-O-[2-deoxy-2-(methylamino)-alpha-L-glucopyranosyl]-3-C-formyl-alpha-L-lyxofuranosyloxy}-2,5,6-trihydroxycyclohexane-1,3-diyl]diguanidine; N,N'''-[(1R,2R,3S,4R,5R,6S)-4-({5-deoxy-2-O-[2-deoxy-2-(methylamino)-alpha-L-glucopyranosyl]-3-C-formyl-alpha-L-lyxofuranosyl}oxy)-2,5,6-trihydroxycyclohexane-1,3-diyl]diguanidine; 2,4-Diguanidino-3,5,6-trihydroxycyclohexyl 5-deoxy-2-O-(2-deoxy-2-methylamino-alpha-L-glucopyranosyl)-3-C-formyl-beta-L-lyxopentanofuranoside; 2-[(1R,2R,3S,4R,5R,6S)-3-(diaminomethylideneamino)-4-[(2R,3R,4R,5S)-3-[(2S,3S,4S,5R,6S)-4,5-dihydroxy-6-(hydroxymethyl)-3-(methylamino)oxan-2-yl]oxy-4-formyl-4-hydroxy-5-methyloxolan-2-yl]oxy-2,5,6-trihydroxycyclohexyl]guanidine; 2-[(1R,2R,3S,4R,5R,6S)-3-(diaminomethylideneamino)-4-[(2S,3S,4S,5R)-3-[(2R,3R,4R,5S,6R)-4,5-dihydroxy-6-(hydroxymethyl)-3-(methylamino)oxan-2-yl]oxy-4-formyl-4-hydroxy-5-methyloxolan-2-yl]oxy-2,5,6-trihydroxycyclohexyl]guanidine; 2-[(1S,2S,3R,4S,5S,6R)-3-(diaminomethylideneamino)-4-[(2R,3R,4R,5S)-3-[(2S,3S,4S,5R,6S)-4,5-dihydroxy-6-(hydroxymethyl)-3-(methylamino)oxan-2-yl]oxy-4-formyl-4-hydroxy-5-methyloxolan-2-yl]oxy-2,5,6-trihydroxycyclohexyl]guanidine; 2-[(1S,4S)-5-(diaminomethylideneamino)-2-[(2R,5S)-3-[(2S,5R)-4,5-dihydroxy-6-(hydroxymethyl)-3-(methylamino)oxan-2-yl]oxy-4-formyl-4-hydroxy-5-methyloxolan-2-yl]oxy-3,4,6-trihydroxycyclohexyl]guanidine; [2-deoxy-2-(dimethylamino)-alpha-L-glucopyranosyl]-(1->2)-[5-deoxy-3-C-formyl-alpha-L-lyxofuranosyl]-(1->4)-{N',N'''-[(1,3,5/2,4,6)-2,4,5,6-tetrahydroxycyclohexane-1,3-diyl]diguanidine} |
| Drug Type |
Small molecular drug |
| Therapeutic Class |
Antibiotics |
| Company |
Merck & Co |
| Structure |
|
| Drug Resistance Mutations |
| Target Name |
Bacterial 30S ribosomal protein S12 (rpsL) |
Target Info |
| Gene Name |
rpsL |
| Uniprot ID |
RS12_MYCTU |
| Species |
Mycobacterium tuberculosis |
| Reference Sequence |
MPTIQQLVRKGRRDKISKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQ
VEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAK
KEKG [Mycobacterium tuberculosis]
|
| Targeted Disease |
Tuberculosis |
| Drug Resistance Mutations |
| Mutation info |
Missense: T40I |
[1], [2] |
|
| Mutation info |
Missense: K43R |
[2], [3] |
|
| Mutation info |
Missense: K88Q |
[2], [4] |
| Mutation Frequency |
9 out of 139 isolates |
|
| Mutation info |
Missense: K88R |
[2], [5] |
| Mutation Frequency |
2 out of 15 isolates |
|
| Mutation info |
Missense: G84V |
[1] |
|
| Mutation info |
Missense: K51N |
[1] |
|
| Mutation info |
Missense: R86W |
[1] |
|
| Mutation info |
Missense: T41S |
[1] |
|
| Mutation info |
Missense: V52G |
[1] |
|
| Mutation info |
Missense: V87L |
[1] |
|
| Mutation info |
Missense: R86P |
[6] |
|
| Mutation info |
Missense: K43T |
[5] |
| Mutation Frequency |
5 out of 15 isolates |
|
| Mutation info |
Missense: R9H |
[4] |
| Mutation Frequency |
1 out of 139 isolates |
|
| Mutation info |
Missense: V93M |
[4] |
| Mutation Frequency |
1 out of 139 isolates |
|
| Mutation info |
Missense: K88M |
[10] |
| Mutation Frequency |
10 out of 17 isolates |
|
| Mutation info |
Missense: K88T |
[10] |
| Mutation Frequency |
10 out of 17 isolates |
|
| Target Name |
Bacterial Glucose-inhibited division protein B (gid) |
Target Info |
| Gene Name |
gid |
| Uniprot ID |
RSMG_MYCTU |
| Species |
Mycobacterium tuberculosis |
| Reference Sequence |
MSPIEPAASAIFGPRLGLARRYAEALAGPGVERGLVGPREVGRLWDRHLLNCAVIGELLE
RGDRVVDIGSGAGLPGVPLAIARPDLQVVLLEPLLRRTEFLREMVTDLGVAVEIVRGRAE
ESWVQDQLGGSDAAVSRAVAALDKLTKWSMPLIRPNGRMLAIKGERAHDEVREHRRVMIA
SGAVDVRVVTCGANYLRPPATVVFARRGKQIARGSARMASGGTA [Mycobacterium
tuberculosis]
|
| Targeted Disease |
Tuberculosis |
| Drug Resistance Mutations |
| Mutation info |
Missense: A134E |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Missense: A138E |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Missense: A183E |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Missense: A200E |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Missense: D67H |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Nonsense: E103 STOP |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Nonsense: E40 STOP |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Missense: E92D |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Missense: G71V |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Missense: I55S |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Missense: L16R |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Missense: P75A |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Frameshift: Plus 117 |
[6] |
|
| Mutation info |
Frameshift: Plus 34 |
[6] |
|
| Mutation info |
Frameshift: Plus 39 |
[6] |
|
| Mutation info |
Nonsense: Q125 STOP |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Missense: Q127P |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Missense: R47Q |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Missense: S70R |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Missense: V188G |
[6] |
| Mutation Frequency |
19 out of 57 isolates in all gidB mutations |
|
| Mutation info |
Missense: W148R |
[8] |
| Mutation Frequency |
4 out of 79 isolates |
|
| Mutation info |
Missense: W45C |
[8] |
| Mutation Frequency |
4 out of 79 isolates |
|
| Target Name |
Bacterial 16S ribosomal RNA (rrs) |
Target Info |
| Gene Name |
rrs |
| Species |
Mycobacterium tuberculosis |
| Targeted Disease |
Tuberculosis |
| Drug Resistance Mutations |
| Mutation info |
Frameshift: Plus 1061 |
[7] |
|
| Mutation info |
Frameshift: Plus 512 |
[9] |
|
| Mutation info |
Frameshift: Plus 907 |
[10] |
| Mutation Frequency |
7 out of 17 patients |
|
| Target Name |
Bacterial DNA gyrase subunit B (gyrB) |
Target Info |
| Gene Name |
gyrB |
| Uniprot ID |
GYRB_MYCTU |
| Species |
Mycobacterium tuberculosis |
| Reference Sequence |
MAAQKKKAQDEYGAASITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAG
YATTVNVVLLEDGGVEVADDGRGIPVATHASGIPTVDVVMTQLHAGGKFDSDAYAISGGL
HGVGVSVVNALSTRLEVEIKRDGYEWSQVYEKSEPLGLKQGAPTKKTGSTVRFWADPAVF
ETTEYDFETVARRLQEMAFLNKGLTINLTDERVTQDEVVDEVVSDVAEAPKSASERAAES
TAPHKVKSRTFHYPGGLVDFVKHINRTKNAIHSSIVDFSGKGTGHEVEIAMQWNAGYSES
VHTFANTINTHEGGTHEEGFRSALTSVVNKYAKDRKLLKDKDPNLTGDDIREGLAAVISV
KVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANPTDAKVVVNKAVSSAQARIAA
RKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAILP
LRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHI
STLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKK
INKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVDARR
SFITRNAKDVRFLDV [Mycobacterium tuberculosis]
|
| Targeted Disease |
Tuberculosis |
| Drug Resistance Mutations |
| Mutation info |
Missense: N52T |
[2] |
|
| References |
| REF 1 |
Molecular characterisation of streptomycin-resistant Mycobacterium tuberculosis strains isolated in Poland. Int J Tuberc Lung Dis. 2004 Aug;8(8):1032-5.
|
| REF 2 |
CARD 2017: expansion and model-centric curation of the comprehensive antibiotic resistance database. Nucleic Acids Res. 2017 Jan 4;45(D1):D566-D573.
|
| REF 3 |
The rpsL gene and streptomycin resistance in single and multiple drug-resistant strains of Mycobacterium tuberculosis. Mol Microbiol. 1993 Nov;10(3):521-7.
|
| REF 4 |
Characterization of rpsL and rrs mutations in streptomycin-resistant Mycobacterium tuberculosis isolates from diverse geographic localities. Antimicrob Agents Chemother. 1996 Apr;40(4):1024-6.
|
| REF 5 |
Molecular basis of streptomycin resistance in Mycobacterium tuberculosis: alterations of the ribosomal protein S12 gene and point mutations within a functional 16S ribosomal RNA pseudoknot. Mol Microbiol. 1993 Sep;9(6):1239-46.
|
| REF 6 |
Loss of a conserved 7-methylguanosine modification in 16S rRNA confers low-level streptomycin resistance in bacteria. Mol Microbiol. 2007 Feb;63(4):1096-106.
|
| REF 7 |
Development and evaluation of a line probe assay for rapid identification of pncA mutations in pyrazinamide-resistant mycobacterium tuberculosis st... J Clin Microbiol. 2007 Sep;45(9):2802-7.
|
| REF 8 |
Identification of mutations related to streptomycin resistance in clinical isolates of Mycobacterium tuberculosis and possible involvement of efflux mechanism. Antimicrob Agents Chemother. 2008 Aug;52(8):2947-9.
|
| REF 9 |
Novel mutation in 16S rRNA associated with streptomycin dependence in Mycobacterium tuberculosis. Antimicrob Agents Chemother. 1995 Mar;39(3):769-70.
|
| REF 10 |
Characterization of the rpsL and rrs genes of streptomycin-resistant clinical isolates of Mycobacterium tuberculosis in Japan. J Appl Microbiol. 1997 Nov;83(5):634-40.
|
