Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T47306 | Target Info | |||
| Target Name | Glucose-6-phosphate translocase (SLC37A4) | ||||
| Synonyms | Transformation-related gene 19 protein; TRG19; TRG-19; Solute carrier family 37 member 4; PRO0685; Glucose-6-phosphate exchanger SLC37A4; Glucose-5-phosphate transporter; Glucose 5-phosphate transporter; G6PT1 | ||||
| Target Type | Literature-reported Target | ||||
| Gene Name | SLC37A4 | ||||
| Biochemical Class | Major facilitator | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | Forkhead box protein O1 (FOXO1) | ||||
| Classification | Superclass | Helix-turn-helix | |||
| Class | Fork head / winged helix | ||||
| Regulation Type | Increase | ||||
| Regulation Mechanism | FOXO1 bound to the probe with the sequence nt -215/-209, and the overexpression of FOXO1 stimulated the induction of SLC37A4 promoter activity by dexamethasone via nt -215/-209 in hepatoma cells. | [1] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Electrophoretic Mobility Shift Assay | [1] | |||
| UniProt ID | |||||
| Sequence |
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPS
ASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHP APPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKR LTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLN PEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPG SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLP SLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN YQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPV DPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLP HTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPS DLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Caveolin proteins | [+] 1 Caveolin proteins Co-regulated By This TF | + | |||
| 1 | Caveolin 1 (CAV1) | Literature-reported Target | Target Info | [2] | |
| Major facilitators | [+] 1 Major facilitators Co-regulated By This TF | + | |||
| 1 | Glucose-6-phosphate translocase (SLC37A4) | Literature-reported Target | Target Info | [1] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | Characterization of cis-elements mediating the stimulation of glucose-6-phosphate transporter promoter activity by glucocorticoids. Gene. 2003 Nov 27;320:59-66. | ||||
| REF 2 | Direct control of caveolin-1 expression by FOXO transcription factors. Biochem J. 2005 Feb 1;385(Pt 3):795-802. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.