Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T57059 | Target Info | |||
| Target Name | E2F transcription factor 1 (E2F1) | ||||
| Synonyms | pRB-binding protein E2F-1; Transcription factor E2F1; Retinoblastoma-binding protein 3; Retinoblastoma-associated protein 1; RBBP3; RBBP-3; RBAP-1; PBR3; E2F-1 | ||||
| Target Type | Clinical trial Target | ||||
| Gene Name | E2F1 | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | E2F transcription factor 1 (E2F-1) homodimer | ||||
| Classification | Superclass | Helix-turn-helix | |||
| Class | Fork head / winged helix | ||||
| Family | Cell-cycle controlling factors | ||||
| Subfamily | E2F | ||||
| Regulation Mechanism | E2F1 transcription has also been shown to be partially repressed by pRB-E2F complexes that bind to autoregulatory E2F sites on the E2F1 promoter. | [1] | |||
| Evidence Score (E-score) | 2 | + | |||
| 1 | Electrophoretic Mobility Shift Assay, In Vitro Transcription Assay | [1] | |||
| 2 | Luciferase Reporter Assay | [2] | |||
| UniProt ID | |||||
| Sequence |
MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK SPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI AKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE ETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLS RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG IRDLFDCDFGDLTPLDF |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Transcription factors | [+] 1 Transcription factors Co-regulated By This TF | + | |||
| 1 | E2F transcription factor 1 (E2F1) | Clinical trial Target | Target Info | [1] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | Transcriptional regulation of E2F-1 and eIF-2 genes by alpha-pal: a potential mechanism for coordinated regulation of protein synthesis, growth, an... Biochim Biophys Acta. 2000 Jan 10;1495(1):51-68. | ||||
| REF 2 | Autoregulatory control of E2F1 expression in response to positive and negative regulators of cell cycle progression. Genes Dev. 1994 Jul 1;8(13):1514-25. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.