Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T23471
(Former ID: TTDC00199)
|
|||||
Target Name |
Myeloperoxidase (MPO)
|
|||||
Synonyms |
MPO
|
|||||
Gene Name |
MPO
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Postoperative inflammation [ICD-11: 1A00-CA43] | |||||
Function |
Part of the host defense system of polymorphonuclear leukocytes. It is responsible for microbicidal activity against a wide range of organisms. In the stimulated PMN, MPO catalyzes the production of hypohalous acids, primarily hypochlorous acidin physiologic situations, and other toxic intermediates that greatly enhance PMN microbicidal activity.
Click to Show/Hide
|
|||||
BioChemical Class |
Peroxidases
|
|||||
UniProt ID | ||||||
EC Number |
EC 1.11.2.2
|
|||||
Sequence |
MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTS
LVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLH VALDLLERKLRSLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMC NNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTD QLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQL GLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYR SYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLE GGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPL LACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMS NSYPRDFVNCSTLPALNLASWREAS Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
ADReCS ID | BADD_A00127 ; BADD_A01943 ; BADD_A02053 ; BADD_A02603 ; BADD_A03271 ; BADD_A03824 ; BADD_A04537 ; BADD_A04561 ; BADD_A06206 ; BADD_A07267 | |||||
HIT2.0 ID | T30VNV |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 3 Clinical Trial Drugs | + | ||||
1 | E-101 | Drug Info | Phase 3 | Infectious disease | [2] | |
2 | AZD-3241 | Drug Info | Phase 2 | Parkinson disease | [3] | |
3 | AZD4831 | Drug Info | Phase 1 | Heart failure | [4] | |
Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
1 | AZD5904 | Drug Info | Discontinued in Phase 1 | Multiple sclerosis | [5], [6] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Modulator | [+] 2 Modulator drugs | + | ||||
1 | E-101 | Drug Info | [1] | |||
2 | AZD4831 | Drug Info | [4] | |||
Inhibitor | [+] 4 Inhibitor drugs | + | ||||
1 | AZD-3241 | Drug Info | [7] | |||
2 | AZD5904 | Drug Info | [8] | |||
3 | 4-aminobenzoic acid hydrazide | Drug Info | [9] | |||
4 | INV-311 | Drug Info | [10] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
1 | Phagosome | |||||
2 | Transcriptional misregulation in cancer | |||||
PID Pathway | [+] 2 PID Pathways | + | ||||
1 | C-MYB transcription factor network | |||||
2 | IL23-mediated signaling events | |||||
WikiPathways | [+] 3 WikiPathways | + | ||||
1 | Folate Metabolism | |||||
2 | Vitamin B12 Metabolism | |||||
3 | Selenium Micronutrient Network |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | In vitro antibacterial activity of E-101 Solution, a novel myeloperoxidase-mediated antimicrobial, against Gram-positive and Gram-negative pathogens. J Antimicrob Chemother. 2011 Feb;66(2):335-42. | |||||
REF 2 | ClinicalTrials.gov (NCT01297959) Efficacy and Safety of E-101 Solution for Preventing Surgical Site Infections After Colorectal Surgery. U.S. National Institutes of Health. | |||||
REF 3 | ClinicalTrials.gov (NCT02388295) AZD3241 PET MSA Trial, Phase 2, Randomized,12 Week Safety and Tolerability Trial With PET in MSA Patients. U.S. National Institutes of Health. | |||||
REF 4 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7728). | |||||
REF 6 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024670) | |||||
REF 7 | Effect of the myeloperoxidase inhibitor AZD3241 on microglia: a PET study in Parkinson's disease. Brain. 2015 Sep;138(Pt 9):2687-700. | |||||
REF 8 | Clinical pipeline report, company report or official report of AstraZeneca (2009). | |||||
REF 9 | Myeloperoxidase expression as a potential determinant of parthenolide-induced apoptosis in leukemia bulk and leukemia stem cells. J Pharmacol Exp Ther. 2010 Nov;335(2):389-400. | |||||
REF 10 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2789). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.