Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T26203
(Former ID: TTDI01933)
|
|||||
| Target Name |
Intercellular adhesion molecule ICAM-1 (ICAM1)
|
|||||
| Synonyms |
Major group rhinovirus receptor; Intercellular adhesion molecule 1; ICAM-1; CD54
|
|||||
| Gene Name |
ICAM1
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Visual system disease [ICD-11: 9E1Z] | |||||
| Function |
During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2).
Click to Show/Hide
|
|||||
| BioChemical Class |
Immunoglobulin
|
|||||
| UniProt ID | ||||||
| Sequence |
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| ADReCS ID | BADD_A02322 ; BADD_A02324 ; BADD_A05290 ; BADD_A05438 ; BADD_A06206 ; BADD_A06414 ; BADD_A08478 | |||||
| HIT2.0 ID | T10HL8 | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | lifitegrast | Drug Info | Approved | Dry eye disease | [2] | |
| Clinical Trial Drug(s) | [+] 4 Clinical Trial Drugs | + | ||||
| 1 | Alicaforsen | Drug Info | Phase 3 | Lleum inflammation | [3] | |
| 2 | APC-8015F | Drug Info | Phase 2 | Prostate cancer | [4] | |
| 3 | BI-505 | Drug Info | Phase 2 | Multiple myeloma | [3] | |
| 4 | AIC100 | Drug Info | Phase 1 | Thyroid cancer | [5] | |
| Discontinued Drug(s) | [+] 3 Discontinued Drugs | + | ||||
| 1 | A-252444.0 | Drug Info | Terminated | Inflammation | [6] | |
| 2 | GI-270384X | Drug Info | Terminated | Inflammatory bowel disease | [7] | |
| 3 | MOR-102 | Drug Info | Terminated | Psoriasis vulgaris | [8] | |
| Mode of Action | [+] 3 Modes of Action | + | ||||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | lifitegrast | Drug Info | [1] | |||
| Antagonist | [+] 2 Antagonist drugs | + | ||||
| 1 | Alicaforsen | Drug Info | [9] | |||
| 2 | A-252444.0 | Drug Info | [13] | |||
| Modulator | [+] 3 Modulator drugs | + | ||||
| 1 | APC-8015F | Drug Info | [10] | |||
| 2 | GI-270384X | Drug Info | [7] | |||
| 3 | ISIS-1939 | Drug Info | [15] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-regulating Transcription Factors | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Discovery and Development of Potent LFA-1/ICAM-1 Antagonist SAR 1118 as an Ophthalmic Solution for Treating Dry Eye. ACS Med Chem Lett. 2012 Jan 31;3(3):203-6. | |||||
| REF 2 | 2016 FDA drug approvals. Nat Rev Drug Discov. 2017 Feb 2;16(2):73-76. | |||||
| REF 3 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 4 | ClinicalTrials.gov (NCT00849290) Immunotherapy For Men With Objective Disease Progression On Protocol D9902 Part B (NCT00065442). U.S. National Institutes of Health. | |||||
| REF 5 | ClinicalTrials.gov (NCT04420754) Study of AIC100 in Relapsed/Refractory Thyroid Cancer. U.S. National Institutes of Health. | |||||
| REF 6 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012566) | |||||
| REF 7 | Inhibition of endothelial cell adhesion molecule expression improves colonic hyperalgaesia. Neurogastroenterol Motil. 2009 Feb;21(2):189-96. | |||||
| REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017213) | |||||
| REF 9 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 10 | National Cancer Institute Drug Dictionary (drug id 561410). | |||||
| REF 11 | A human ICAM-1 antibody isolated by a function-first approach has potent macrophage-dependent antimyeloma activity in vivo. Cancer Cell. 2013 Apr 15;23(4):502-15. | |||||
| REF 12 | Clinical pipeline report, company report or official report of AffyImmune Therapeutics. | |||||
| REF 13 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012566) | |||||
| REF 14 | Efficacy of the fully human monoclonal antibody MOR102 (#5) against intercellular adhesion molecule 1 in the psoriasis-severe combined immunodeficient mouse model. Br J Dermatol. 2005 Oct;153(4):758-66. | |||||
| REF 15 | Antisense oligonucleotides inhibit intercellular adhesion molecule 1 expression by two distinct mechanisms. J Biol Chem. 1991 Sep 25;266(27):18162-71. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.