Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T33990
(Former ID: TTDC00263)
|
|||||
| Target Name |
Macrophage colony-stimulating factor 1 (CSF1)
|
|||||
| Synonyms |
Processed macrophagecolony-stimulating factor 1; MCSF; M-CSF; Lanimostim; CSF-1
|
|||||
| Gene Name |
CSF1
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Inflammatory arthropathy [ICD-11: FA2Z] | |||||
| 2 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| Function |
Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance. Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
TSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLK SCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS QDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQP LHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMG TNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPA DVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG HERQSEGSFSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEG SPLTQDDRQVELPV Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| HIT2.0 ID | T22BA6 | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 4 Clinical Trial Drugs | + | ||||
| 1 | RG7155 | Drug Info | Phase 2 | Solid tumour/cancer | [2] | |
| 2 | Emactuzumab | Drug Info | Phase 1 | Solid tumour/cancer | [3] | |
| 3 | MSC110 | Drug Info | Phase 1 | Pigmented villonodular synovitis | [4] | |
| 4 | PLX73086 | Drug Info | Phase 1 | Solid tumour/cancer | [1] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Antagonist | [+] 3 Antagonist drugs | + | ||||
| 1 | RG7155 | Drug Info | [1] | |||
| 2 | Emactuzumab | Drug Info | [3] | |||
| 3 | PLX73086 | Drug Info | [1] | |||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | MSC110 | Drug Info | [4] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 8 KEGG Pathways | + | ||||
| 1 | Ras signaling pathway | |||||
| 2 | Rap1 signaling pathway | |||||
| 3 | Cytokine-cytokine receptor interaction | |||||
| 4 | PI3K-Akt signaling pathway | |||||
| 5 | Osteoclast differentiation | |||||
| 6 | Hematopoietic cell lineage | |||||
| 7 | TNF signaling pathway | |||||
| 8 | Rheumatoid arthritis | |||||
| NetPath Pathway | [+] 4 NetPath Pathways | + | ||||
| 1 | TSH Signaling Pathway | |||||
| 2 | IL2 Signaling Pathway | |||||
| 3 | EGFR1 Signaling Pathway | |||||
| 4 | TGF_beta_Receptor Signaling Pathway | |||||
| PID Pathway | [+] 3 PID Pathways | + | ||||
| 1 | Signaling events mediated by PTP1B | |||||
| 2 | Signaling events mediated by TCPTP | |||||
| 3 | Integrins in angiogenesis | |||||
| WikiPathways | [+] 5 WikiPathways | + | ||||
| 1 | Cytokines and Inflammatory Response | |||||
| 2 | Hematopoietic Stem Cell Differentiation | |||||
| 3 | Differentiation Pathway | |||||
| 4 | miR-targeted genes in muscle cell - TarBase | |||||
| 5 | Folate Metabolism | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035593) | |||||
| REF 3 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 4 | Colony-Stimulating Factor-1 Antibody Lacnotuzumab in a Phase 1 Healthy Volunteer Study and Mechanistic Investigation of Safety Outcomes. J Pharmacol Exp Ther. 2019 Jun;369(3):428-442. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.