Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T66426
(Former ID: TTDI02038)
|
|||||
Target Name |
Hematopoietic progenitor cell antigen CD34 (CD34)
|
|||||
Synonyms |
CD34 molecule
|
|||||
Gene Name |
CD34
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 3 Target-related Diseases | + | ||||
1 | Heart failure [ICD-11: BD10-BD1Z] | |||||
2 | Acute myeloid leukaemia [ICD-11: 2A60] | |||||
3 | Myelodysplastic syndrome [ICD-11: 2A37] | |||||
Function |
Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins. Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQE
TTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTV FTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGI REVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRP QCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGAL LAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQ ENGTGQATSRNGHSARQHVVADTEL Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T06SWE |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | AMR-001 | Drug Info | Phase 2 | Heart failure | [2] | |
2 | CART-34 cells | Drug Info | Phase 1 | Myelodysplastic syndrome | [3] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | CAR-T cells targeting CD34 | Drug Info | Preclinical | Acute myeloid leukaemia | [4] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | AMR-001 | Drug Info | [1] | |||
CAR-T-Cell-Therapy | [+] 2 CAR-T-Cell-Therapy drugs | + | ||||
1 | CART-34 cells | Drug Info | [3] | |||
2 | CAR-T cells targeting CD34 | Drug Info | [4] |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-regulating Transcription Factors |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
1 | TGF_beta_Receptor Signaling Pathway | |||||
PID Pathway | [+] 1 PID Pathways | + | ||||
1 | C-MYB transcription factor network | |||||
WikiPathways | [+] 2 WikiPathways | + | ||||
1 | Hematopoietic Stem Cell Differentiation | |||||
2 | Hair Follicle Development: Cytodifferentiation (Part 3 of 3) |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | National Cancer Institute Drug Dictionary (drug id 743421). | |||||
REF 2 | ClinicalTrials.gov (NCT01495364) NBS10 (Also Known as AMR-001) Versus Placebo Post ST Segment Elevation Myocardial Infarction. U.S. National Institutes of Health. | |||||
REF 3 | ClinicalTrials.gov (NCT03291444) CAR-T Cells Combined With Peptide Specific Dendritic Cell in Relapsed/Refractory Leukemia/MDS | |||||
REF 4 | ClinicalTrials.gov (NCT03473457) CAR-T Cells Therapy in Relapsed/Refractory Acute Myeloid Leukemia |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.