Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T77664
(Former ID: TTDC00096)
|
|||||
| Target Name |
Interferon-gamma (IFNG)
|
|||||
| Synonyms |
Interferon gamma; Immune interferon; IFN-gamma
|
|||||
| Gene Name |
IFNG
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Adaptive immunity immunodeficiency [ICD-11: 4A01] | |||||
| Function |
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Click to Show/Hide
|
|||||
| BioChemical Class |
Cytokine: interferon
|
|||||
| UniProt ID | ||||||
| Sequence |
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| ADReCS ID | BADD_A03065 | |||||
| HIT2.0 ID | T37VLU | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Emapalumab | Drug Info | Approved | Primary haemophagocytic lymphohistiocytosis | [1] | |
| Clinical Trial Drug(s) | [+] 4 Clinical Trial Drugs | + | ||||
| 1 | Fumaric acid | Drug Info | Phase 3 | Multiple sclerosis | [2] | |
| 2 | VIR-201 | Drug Info | Phase 1/2 | Human immunodeficiency virus infection | [3] | |
| 3 | AMG 811 | Drug Info | Phase 1 | Systemic lupus erythematosus | [4] | |
| 4 | CIGB-128 | Drug Info | Phase 1 | Basal cell carcinoma | [5] | |
| Discontinued Drug(s) | [+] 4 Discontinued Drugs | + | ||||
| 1 | CRx-191 | Drug Info | Discontinued in Phase 2 | Psoriatic disorder | [6] | |
| 2 | Fontolizumab | Drug Info | Discontinued in Phase 2 | Rheumatoid arthritis | [7] | |
| 3 | TAK-603 | Drug Info | Discontinued in Phase 2 | Inflammatory bowel disease | [8] | |
| 4 | TG-1042 | Drug Info | Discontinued in Phase 2 | B-cell lymphoma | [9] | |
| Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
| 1 | VPM-4-001 | Drug Info | Preclinical | Prostate cancer | [10] | |
| Mode of Action | [+] 3 Modes of Action | + | ||||
| Modulator | [+] 6 Modulator drugs | + | ||||
| 1 | Emapalumab | Drug Info | [1] | |||
| 2 | VIR-201 | Drug Info | [11] | |||
| 3 | AMG 811 | Drug Info | [12] | |||
| 4 | CIGB-128 | Drug Info | [13] | |||
| 5 | TAK-603 | Drug Info | [16] | |||
| 6 | TG-1042 | Drug Info | [17] | |||
| Binder | [+] 1 Binder drugs | + | ||||
| 1 | Fumaric acid | Drug Info | [2] | |||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | CRx-191 | Drug Info | [14] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-regulating Transcription Factors | ||||||
| Target-interacting Proteins | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | 2018 FDA drug approvals.Nat Rev Drug Discov. 2019 Feb;18(2):85-89. | |||||
| REF 2 | Emerging oral drugs for multiple sclerosis. Expert Opin Emerg Drugs. 2008 Sep;13(3):465-77. | |||||
| REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010310) | |||||
| REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028077) | |||||
| REF 5 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800037683) | |||||
| REF 6 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025635) | |||||
| REF 7 | Emerging drugs for rheumatoid arthritis. Expert Opin Emerg Drugs. 2008 Mar;13(1):175-96. | |||||
| REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006011) | |||||
| REF 9 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010265) | |||||
| REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023655) | |||||
| REF 11 | EP patent application no. 17782511, Nucleoside phosphonate conjugates as anti hiv agents. | |||||
| REF 12 | Pharmacokinetic and pharmacodynamic relationship of AMG 811, an anti-IFN-gamma IgG1 monoclonal antibody, in patients with systemic lupus erythematosus. Pharm Res. 2015 Feb;32(2):640-53. | |||||
| REF 13 | Pharmacokinetic and pharmacodynamic characterization of a new formulation containing synergistic proportions of interferons alpha-2b and gamma (HeberPAG) in patients with mycosis fungoides: an open-label trial.BMC Pharmacol Toxicol.2012 Dec 28;13:20. | |||||
| REF 14 | CombinatoRx Drug Candidate CRx-191 Demonstrates Positive Phase 2 Results In Psoriasis. CombinatoRx. 2008. | |||||
| REF 15 | Emerging drugs to treat Crohn's disease. Expert Opin Emerg Drugs. 2007 Mar;12(1):49-59. | |||||
| REF 16 | T helper 1 inhibitor TAK-603 inhibits IFN-gamma and IL-12 production with no effect on IL-18: an observation in sarcoidosis patients. Sarcoidosis Vasc Diffuse Lung Dis. 2004 Oct;21(3):204-11. | |||||
| REF 17 | Drug evaluation: TG-1042, an adenovirus-mediated IFNgamma gene delivery for the intratumoral therapy of primary cutaneous lymphomas. Curr Opin Investig Drugs. 2007 Jun;8(6):493-8. | |||||
| REF 18 | BioPartnering North America--Programs from Pharma in Europe and the Middle East. IDrugs. 2010 Mar;13(3):162-5. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.