Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T85529
(Former ID: TTDC00208)
|
|||||
| Target Name |
T-cell-specific surface glycoprotein CD28 (CD28)
|
|||||
| Synonyms |
TP44; CD28-S2
|
|||||
| Gene Name |
CD28
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Transplant rejection [ICD-11: NE84] | |||||
| Function |
Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation. Isoform 3 enhances CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells. Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLD
SAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPP PYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVR SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| HIT2.0 ID | T90QGN | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Belatacept | Drug Info | Approved | Kidney transplant rejection | [2], [3] | |
| Clinical Trial Drug(s) | [+] 7 Clinical Trial Drugs | + | ||||
| 1 | AB-103 | Drug Info | Phase 3 | Necrotizing soft tissue infection | [4] | |
| 2 | Lulizumab pegol | Drug Info | Phase 2 | Systemic lupus erythematosus | [5] | |
| 3 | AU101 | Drug Info | Phase 1/2 | Osteosarcoma | [6], [7] | |
| 4 | REGN5678 | Drug Info | Phase 1/2 | Prostate cancer | [8] | |
| 5 | CD19-CAR and CD28-CAR T Cells | Drug Info | Phase 1 | Acute lymphoblastic leukaemia | [9] | |
| 6 | CD28 and CD137 CAR-T Cells | Drug Info | Phase 1 | Acute lymphoblastic leukaemia | [10] | |
| 7 | SAR442257 | Drug Info | Phase 1 | Malignant neoplasm | [11] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | TGN-1412 | Drug Info | Discontinued in Phase 1 | Autoimmune diabetes | [12] | |
| Mode of Action | [+] 5 Modes of Action | + | ||||
| Inhibitor | [+] 3 Inhibitor drugs | + | ||||
| 1 | Belatacept | Drug Info | [1] | |||
| 2 | REGN5678 | Drug Info | [15] | |||
| 3 | SAR442257 | Drug Info | [16] | |||
| Antagonist | [+] 1 Antagonist drugs | + | ||||
| 1 | AB-103 | Drug Info | [13], [14] | |||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | Lulizumab pegol | Drug Info | [5] | |||
| Immunomodulator | [+] 1 Immunomodulator drugs | + | ||||
| 1 | AU101 | Drug Info | [6] | |||
| CAR-T-Cell-Therapy(Dual specific) | [+] 2 CAR-T-Cell-Therapy(Dual specific) drugs | + | ||||
| 1 | CD19-CAR and CD28-CAR T Cells | Drug Info | [9] | |||
| 2 | CD28 and CD137 CAR-T Cells | Drug Info | [10] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6892). | |||||
| REF 3 | 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4. | |||||
| REF 4 | ClinicalTrials.gov (NCT02469857) Phase III Efficacy and Safety Study of AB103 in the Treatment of Patients With Necrotizing Soft Tissue Infections. | |||||
| REF 5 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 6 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 7 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 8 | ClinicalTrials.gov (NCT03972657) Study of REGN5678 (Anti-PSMAxCD28) With Cemiplimab (Anti-PD-1) in Patients With Metastatic Castration-resistant Prostate Cancer. U.S. National Institutes of Health. | |||||
| REF 9 | ClinicalTrials.gov (NCT02146924) Cellular Immunotherapy in Treating Patients With High-Risk Acute Lymphoblastic Leukemia | |||||
| REF 10 | ClinicalTrials.gov (NCT02186860) Chimeric Antigen Receptor (CAR)-Modified T Cell Therapy in Treating Patients With Acute Lymphoblastic Leukemia | |||||
| REF 11 | ClinicalTrials.gov (NCT04401020) First-in-human Single Agent Study of SAR442257 in RRMM and RR-NHL. U.S. National Institutes of Health. | |||||
| REF 12 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020365) | |||||
| REF 13 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 14 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 15 | Clinical pipeline report, company report or official report of Regeneron Pharmaceuticals. | |||||
| REF 16 | Clinical pipeline report, company report or official report of Sanofi. | |||||
| REF 17 | TGN1412: From Discovery to Disaster. J Young Pharm. 2010 Jul-Sep; 2(3): 332-336. | |||||
| REF 18 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2863). | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.