Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T95479
(Former ID: TTDS00497)
|
|||||
| Target Name |
Somatostatin (SST)
|
|||||
| Synonyms |
Somatostatin-28; Somatostatin-14; SST; Growth hormone release-inhibiting factor
|
|||||
| Gene Name |
SST
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Amino acid absorption/transport disorder [ICD-11: 5C60] | |||||
| Function |
Somatostatin inhibits the release of somatotropin.
Click to Show/Hide
|
|||||
| BioChemical Class |
Somatostatin cortistatin
|
|||||
| UniProt ID | ||||||
| Sequence |
MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP
NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Cysteamine | Drug Info | Approved | Nephropathic cystinosis | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Binder | [+] 1 Binder drugs | + | ||||
| 1 | Cysteamine | Drug Info | [1] | |||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
| 1 | Gastric acid secretion | |||||
| Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
| 1 | Gastric Acid Production | |||||
| Reactome | [+] 2 Reactome Pathways | + | ||||
| 1 | Peptide ligand-binding receptors | |||||
| 2 | G alpha (i) signalling events | |||||
| WikiPathways | [+] 3 WikiPathways | + | ||||
| 1 | SIDS Susceptibility Pathways | |||||
| 2 | GPCR ligand binding | |||||
| 3 | GPCR downstream signaling | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Somatostatin, Alzheimer's disease and cognition: an old story coming of age Prog Neurobiol. 2009 Oct;89(2):153-61. | |||||
| REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.