Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T05089
(Former ID: TTDNS00606)
|
|||||
| Target Name |
Calcium-dependent chloride channel anoctamin (ANO)
|
|||||
| Synonyms |
Tumoramplified and overexpressed sequence 2; Tumor-amplified and overexpressed sequence 2; Transmembrane protein 16A; TMEM16A; TAOS2; Oral cancer overexpressed protein 2; ORAOV2; Discovered on gastrointestinal stromal tumors protein 1; DOG1; Anoctamin1; Anoctamin-1
|
|||||
| Gene Name |
ANO1
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Gout [ICD-11: FA25] | |||||
| 2 | Viral intestinal infection [ICD-11: 1A2Z] | |||||
| Function |
Required for the normal functioning of the interstitial cells of Cajal (ICCs) which generate electrical pacemaker activity in gastrointestinal smooth muscles. Acts as a major contributor to basal and stimulated chloride conductance in airway epithelial cells and plays an important role in tracheal cartilage development. Calcium-activated chloride channel (CaCC) which plays a role in transepithelial anion transport and smooth muscle contraction.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MRVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRR
KVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHPLPGKGASLDAGSGEPPMDYH EDDKRFRREEYEGNLLEAGLELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKK MYHINETRGLLKKINSVLQKITDPIQPKVAEHRPQTMKRLSYPFSREKQHLFDLSDKDSF FDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAAYPLHDGDYNGENVEFNDRKL LYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGIIVFLYGCATM DENIPSMEMCDQRHNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWA ATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESRNKEKRRHI PEESTNKWKQRVKTAMAGVKLTDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIY RISMAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEK SFEERLIFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEECAPGGCLMEL CIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSPPDHEECVKRKQRYEVDYNLE PFAGLTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAVRA KDIGIWYNILRGIGKLAVIINAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNV SDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNL VMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPC NHHNTKACPDSLGSPAPSHAYHGGVL Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| HIT2.0 ID | T25M2J | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 2 Approved Drugs | + | ||||
| 1 | Benzbromarone | Drug Info | Approved | Gout | [2] | |
| 2 | Crofelemer | Drug Info | Approved | HIV-associated diarrhoea | [1], [3], [4] | |
| Mode of Action | [+] 3 Modes of Action | + | ||||
| Antagonist | [+] 1 Antagonist drugs | + | ||||
| 1 | Benzbromarone | Drug Info | [5] | |||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | Crofelemer | Drug Info | [1], [4] | |||
| Blocker (channel blocker) | [+] 7 Blocker (channel blocker) drugs | + | ||||
| 1 | 9-anthroic acid | Drug Info | [6] | |||
| 2 | DCDPC | Drug Info | [6] | |||
| 3 | DIDS | Drug Info | [6] | |||
| 4 | Ins(3,4,5,6)P4 | Drug Info | [6] | |||
| 5 | NPPB | Drug Info | [6] | |||
| 6 | SITS | Drug Info | [6] | |||
| 7 | tannic acid | Drug Info | [6] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| Reactome | [+] 1 Reactome Pathways | + | ||||
| 1 | Stimuli-sensing channels | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Nat Rev Drug Discov. 2013 Feb;12(2):87-90. | |||||
| REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 3 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7453). | |||||
| REF 4 | Crofelemer, an antisecretory antidiarrheal proanthocyanidin oligomer extracted from Croton lechleri, targets two distinct intestinal chloride channels. Mol Pharmacol. 2010 Jan;77(1):69-78. | |||||
| REF 5 | Anoctamin Channels in Human Myometrium: A Novel Target for Tocolysis.Reprod Sci. 2018 Nov;25(11):1589-1600. | |||||
| REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 708). | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.