Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T06475
(Former ID: TTDR00575)
|
|||||
| Target Name |
Nucleolin (NCL)
|
|||||
| Synonyms |
Protein C23
|
|||||
| Gene Name |
NCL
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Leukaemia [ICD-11: 2A60-2B33] | |||||
| 2 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| Function |
It is found associated with intranucleolar chromatin and pre-ribosomal particles. It induces chromatin decondensation by binding to histone H1. It is thought to play a role in pre-rRNA transcription and ribosome assembly. May play a role in the process of transcriptional elongation. Binds RNA oligonucleotides with 5'-UUAGGG-3' repeats more tightly than the telomeric single-stranded DNA 5'-TTAGGG-3' repeats. Nucleolin is the major nucleolar protein of growing eukaryotic cells.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATS
AKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVA TPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAA APASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEE DDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEG TEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDL EKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIR LVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNST WSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEAL NSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARI VTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGR GGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| HIT2.0 ID | T41A2B | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 3 Clinical Trial Drugs | + | ||||
| 1 | ACT-GRO-777 | Drug Info | Phase 2 | Solid tumour/cancer | [2] | |
| 2 | Itarnafloxin | Drug Info | Phase 2 | leukaemia | [1] | |
| 3 | IPP-204106 | Drug Info | Phase 1/2 | Solid tumour/cancer | [3] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | Itarnafloxin | Drug Info | [1] | |||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | IPP-204106 | Drug Info | [5] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-interacting Proteins | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| NetPath Pathway | [+] 2 NetPath Pathways | + | ||||
| 1 | TCR Signaling Pathway | |||||
| 2 | IL2 Signaling Pathway | |||||
| PID Pathway | [+] 4 PID Pathways | + | ||||
| 1 | Aurora B signaling | |||||
| 2 | Validated targets of C-MYC transcriptional activation | |||||
| 3 | Regulation of Telomerase | |||||
| 4 | Urokinase-type plasminogen activator (uPA) and uPAR-mediated signaling | |||||
| WikiPathways | [+] 5 WikiPathways | + | ||||
| 1 | Pathogenic Escherichia coli infection | |||||
| 2 | miR-targeted genes in squamous cell - TarBase | |||||
| 3 | miR-targeted genes in muscle cell - TarBase | |||||
| 4 | miR-targeted genes in lymphocytes - TarBase | |||||
| 5 | miR-targeted genes in epithelium - TarBase | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Targeting G-quadruplexes in gene promoters: a novel anticancer strategy . Nat Rev Drug Discov. 2011 April; 10(4): 261-275. | |||||
| REF 2 | ClinicalTrials.gov (NCT00740441) A Phase II Study of AS1411 in Renal Cell Carcinoma. U.S. National Institutes of Health. | |||||
| REF 3 | ClinicalTrials.gov (NCT01711398) Dose-finding Adaptive Phase I/IIa Study to Assess Safety, Tolerability, Pharmacokinetics and Preliminary Efficacy of IPP-204106N on Advanced Solid Tumors. U.S. National Institutes of Health. | |||||
| REF 4 | Nucleic Acid Aptamers as Potential Therapeutic and Diagnostic Agents for Lymphoma. J Cancer Ther. 2013 June 1; 4(4): 872-890. | |||||
| REF 5 | Company report (ImmuPharma) | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.