Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T14582
(Former ID: TTDR00158)
|
|||||
Target Name |
Mycobacterium Biosynthetic alanine racemase (MycB alr)
|
|||||
Synonyms |
D-alanine racemase; Alr; Alanine racemase; AlaR
Click to Show/Hide
|
|||||
Gene Name |
MycB alr
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Bacterial infection [ICD-11: 1A00-1C4Z] | |||||
2 | HIV-infected patients with tuberculosis [ICD-11: 1B10-1B14] | |||||
Function |
Catalyzes the interconversion of L-alanine and D- alanine. Overexpression due to a natural mutation in the promoter is responsible for mediating resistance to D-cycloserine (DCS) in mycobacteria.
Click to Show/Hide
|
|||||
BioChemical Class |
Racemases and epimerases
|
|||||
UniProt ID | ||||||
EC Number |
EC 5.1.1.1
|
|||||
Sequence |
MQTTEPMTPPAPLASAQTVIDLGAIDHNVRVLRELAGSADVMAVVKADAYGHGALPVART
ALAAGAAALGVATIPEALALREGGITAPVLAWLHPPGTDFAPAIAADVEVAVSSRRQLEQ VTAAAAEVGRTATVTVKVDTGLSRNGVGAADYPEVLDVLRRAQADGAIRVRGLMSHLVHG DDPENPFNGLQGQRLADMRVYAREHGVDYEVAHLCNSPAAMTRPDLAFEMVRPGISLYGL SPIPERGDMGLRPAMTLKCPVALVRSVHAGDGVSYGHRWVADRDTTLGLLPIGYADGVYR ALSGRIDVLIKGRRRRAVGRICMDQFVVDLGPDADDVAVGDDAILFGPGANGEPTAQDWA ELLDTIHYEVVTSPRGRVTRTYLPAGQQD Click to Show/Hide
|
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
1 | Cycloserine | Drug Info | Approved | Tuberculosis | [2], [3] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Inhibitor | [+] 10 Inhibitor drugs | + | ||||
1 | Cycloserine | Drug Info | [1] | |||
2 | 3-fluorovinylglycine | Drug Info | [4] | |||
3 | Acetate Ion | Drug Info | [1] | |||
4 | Lysine Nz-Carboxylic Acid | Drug Info | [1] | |||
5 | N-(5'-Phosphopyridoxyl)-D-Alanine | Drug Info | [1] | |||
6 | Propanoic Acid | Drug Info | [1] | |||
7 | Propionate | Drug Info | [5] | |||
8 | Pyridoxamine-5'-Phosphate | Drug Info | [1] | |||
9 | Pyridoxyl-Alanine-5-Phosphate | Drug Info | [1] | |||
10 | Pyridoxyl-N,O-Cycloserylamide-5-Monophosphate | Drug Info | [1] |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
REF 2 | Novel agents in the management of Mycobacterium tuberculosis disease. Curr Med Chem. 2007;14(18):2000-8. | |||||
REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 4 | Mechanism-based inactivation of alanine racemase by 3-halovinylglycines. J Biol Chem. 1991 Nov 15;266(32):21657-65. | |||||
REF 5 | Molecular dynamics studies of alanine racemase: a structural model for drug design. Biopolymers. 2003 Oct;70(2):186-200. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.