Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T18779
(Former ID: TTDR00730)
|
|||||
| Target Name |
Mucin-1 (MUC1)
|
|||||
| Synonyms |
Tumour-associated antigen mucin 1; Tumor-associated mucin; Tumor-associated epithelial membraneantigen; Tumor-associated epithelial membrane antigen; Polymorphic epithelial mucin; Peanut-reactive urinary mucin; PUM; PEMT; PEM; MUC-1; Krebs von den Lungen-6; KL-6; H23AG; Episialin; EMA; Carcinoma-associated mucin; Cancer antigen 15-3; CD227 antigen; CD227; CA 15-3; Breast carcinoma-associated antigen DF3
|
|||||
| Gene Name |
MUC1
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 3 Target-related Diseases | + | ||||
| 1 | Pancreatic cancer [ICD-11: 2C10] | |||||
| 2 | Bipolar disorder [ICD-11: 6A60] | |||||
| 3 | Lung cancer [ICD-11: 2C25] | |||||
| Function |
Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack. The alpha subunit has cell adhesive properties.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSV
LSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTS APDNKPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDNRPALGSTAPPVHNVTS ASGSASGSASTLVHNGTSARATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHS SVPPLTSSNHSTSPQLSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQI YKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVS VSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPAR DTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| HIT2.0 ID | T36S9V | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 28 Clinical Trial Drugs | + | ||||
| 1 | Yttrium (90Y) clivatuzumab tetraxetan | Drug Info | Phase 3 | Pancreatic cancer | [2], [3] | |
| 2 | TG-4010 | Drug Info | Phase 2/3 | Bipolar disorder | [4] | |
| 3 | AS-1402 | Drug Info | Phase 2 | Breast cancer | [5] | |
| 4 | Emepepimut-S | Drug Info | Phase 2 | Non-small-cell lung cancer | [6] | |
| 5 | GO-203-2c | Drug Info | Phase 2 | Acute myeloid leukaemia | [7] | |
| 6 | ICO-25 | Drug Info | Phase 2 | Breast cancer | [8] | |
| 7 | MUC1-Poly-ICLC | Drug Info | Phase 2 | Colorectal cancer | [9] | |
| 8 | Pankomab-GEX | Drug Info | Phase 2 | Solid tumour/cancer | [10] | |
| 9 | SAR-566658 | Drug Info | Phase 2 | Triple negative breast cancer | [7] | |
| 10 | Anti-MUC1 CAR T Cells | Drug Info | Phase 1/2 | Breast cancer | [11] | |
| 11 | Anti-MUC1 CAR T Cells | Drug Info | Phase 1/2 | Lung cancer | [12] | |
| 12 | Anti-MUC1 CAR-T cells | Drug Info | Phase 1/2 | Colorectal cancer | [13] | |
| 13 | Anti-MUC1 CAR-T cells | Drug Info | Phase 1/2 | Esophageal cancer | [14] | |
| 14 | BrevaRex | Drug Info | Phase 1/2 | Pancreatic cancer | [15] | |
| 15 | CAR-T cells targeting Muc1 | Drug Info | Phase 1/2 | Cervical cancer | [16] | |
| 16 | CAR-T cells targeting MucI | Drug Info | Phase 1/2 | Lung cancer | [17] | |
| 17 | G0-203-2c | Drug Info | Phase 1/2 | Pancreatic cancer | [18] | |
| 18 | ImMucin | Drug Info | Phase 1/2 | Multiple myeloma | [19] | |
| 19 | MUC-1 CART cell immunotherapy | Drug Info | Phase 1/2 | Intrahepatic cholangiocarcinoma | [20] | |
| 20 | Muc1-specific gene-engineered T cells | Drug Info | Phase 1/2 | Acute myeloid leukaemia | [21] | |
| 21 | Anti-MUC1 mab | Drug Info | Phase 1 | Pancreatic cancer | [22] | |
| 22 | CAR-T cells targeting MUC1 | Drug Info | Phase 1 | Solid tumour/cancer | [23] | |
| 23 | CAR-T Cells targeting MUCI | Drug Info | Phase 1 | Pancreatic cancer | [24] | |
| 24 | CART-Muc1 cells | Drug Info | Phase 1 | Myelodysplastic syndrome | [25] | |
| 25 | HuMNC2-CAR44 T cells | Drug Info | Phase 1 | Breast cancer | [26] | |
| 26 | MUC-1 dendritic cancer vaccine | Drug Info | Phase 1 | Solid tumour/cancer | [27] | |
| 27 | ONT-10 | Drug Info | Phase 1 | Solid tumour/cancer | [28] | |
| 28 | TnMUC-1 CAR-T cell therapy | Drug Info | Phase 1 | Solid tumour/cancer | [29] | |
| Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
| 1 | CAR-T cells targeting Mucl | Drug Info | Preclinical | Acute myeloid leukaemia | [30] | |
| Mode of Action | [+] 3 Modes of Action | + | ||||
| Modulator | [+] 4 Modulator drugs | + | ||||
| 1 | TG-4010 | Drug Info | [4] | |||
| 2 | G0-203-2c | Drug Info | [32] | |||
| 3 | Anti-MUC1 mab | Drug Info | [40] | |||
| 4 | TG-1031 | Drug Info | [44] | |||
| Inhibitor | [+] 2 Inhibitor drugs | + | ||||
| 1 | GO-203-2c | Drug Info | [32] | |||
| 2 | TnMUC-1 CAR-T cell therapy | Drug Info | [29] | |||
| CAR-T-Cell-Therapy | [+] 12 CAR-T-Cell-Therapy drugs | + | ||||
| 1 | Anti-MUC1 CAR T Cells | Drug Info | [11] | |||
| 2 | Anti-MUC1 CAR T Cells | Drug Info | [12] | |||
| 3 | Anti-MUC1 CAR-T cells | Drug Info | [13] | |||
| 4 | Anti-MUC1 CAR-T cells | Drug Info | [14] | |||
| 5 | CAR-T cells targeting Muc1 | Drug Info | [16] | |||
| 6 | CAR-T cells targeting MucI | Drug Info | [17], [38] | |||
| 7 | MUC-1 CART cell immunotherapy | Drug Info | [20] | |||
| 8 | Muc1-specific gene-engineered T cells | Drug Info | [21] | |||
| 9 | CAR-T cells targeting MUC1 | Drug Info | [23] | |||
| 10 | CAR-T Cells targeting MUCI | Drug Info | [24] | |||
| 11 | CART-Muc1 cells | Drug Info | [25] | |||
| 12 | CAR-T cells targeting Mucl | Drug Info | [30] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-interacting Proteins | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| WikiPathways | [+] 1 WikiPathways | + | ||||
| 1 | Hematopoietic Stem Cell Differentiation | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Clinical pipeline report, company report or official report of Immunomedics. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8087). | |||||
| REF 3 | ClinicalTrials.gov (NCT01956812) Phase 3 Trial of 90Y-Clivatuzumab Tetraxetan & Gemcitabine vs Placebo & Gemcitabine in Metastatic Pancreatic Cancer. U.S. National Institutes of Health. | |||||
| REF 4 | A phase II study of Tg4010 (Mva-Muc1-Il2) in association with chemotherapy in patients with stage III/IV Non-small cell lung cancer. J Thorac Oncol. 2008 Jul;3(7):735-44. | |||||
| REF 5 | Phase I dose escalation pharmacokinetic assessment of intravenous humanized anti-MUC1 antibody AS1402 in patients with advanced breast cancer. Breast Cancer Res. 2009;11(5):R73. | |||||
| REF 6 | ClinicalTrials.gov (NCT00828009) BLP25 Liposome Vaccine and Bevacizumab After Chemotherapy and Radiation Therapy in Treating Patients With Newly Diagnosed Stage IIIA or Stage IIIB Non-Small Cell LungCancer That Cannot Be Removed by Surgery. U.S. National Institutes of Health. | |||||
| REF 7 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 8 | Atemonate and Imuteran: novel Russian monoclonal antibody-based therapeutic agents. Biotechnol J. 2007 Jul;2(7):863-70. | |||||
| REF 9 | ClinicalTrials.gov (NCT00773097) Study of the MUC1 Peptide-Poly-ICLC Adjuvant Vaccine in Individuals With Advanced Colorectal Adenoma. U.S. National Institutes of Health. | |||||
| REF 10 | ClinicalTrials.gov (NCT01899599) PankoMab-GEX Versus Placebo as Maintenance Therapy in Advanced Ovarian Cancer. U.S. National Institutes of Health. | |||||
| REF 11 | ClinicalTrials.gov (NCT02587689) Phase I/II Study of Anti-Mucin1 (MUC1) CAR T Cells for Patients With MUC1+ Advanced Refractory Solid Tumor | |||||
| REF 12 | ClinicalTrials.gov (NCT03525782) Anti-MUC1 CAR T Cells and PD-1 Knockout Engineered T Cells for NSCLC | |||||
| REF 13 | ClinicalTrials.gov (NCT02617134) CAR-T Cell Immunotherapy in MUC1 Positive Solid Tumor | |||||
| REF 14 | ClinicalTrials.gov (NCT03706326) CAR T and PD-1 Knockout Engineered T Cells for Esophageal Cancer | |||||
| REF 15 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010209) | |||||
| REF 16 | ClinicalTrials.gov (NCT03356795) Intervention of CAR-T Against Cervical Cancer | |||||
| REF 17 | ClinicalTrials.gov (NCT03356808) Antigen-specific T Cells Against Lung Cancer | |||||
| REF 18 | ClinicalTrials.gov (NCT02204085) A Phase I/II Trial of the MUC1 Inhibitor, GO-203-2C in Patients With Relapsed or Refractory Acute Myeloid Leukemia. U.S. National Institutes of Health. | |||||
| REF 19 | ClinicalTrials.gov (NCT01232712) A Study to Assess the Safety and Efficacy of MUC1 Peptide Vaccine and hGM-CSF in Patients With MUC1-positive Tumor Malignancies. U.S. National Institutes of Health. | |||||
| REF 20 | ClinicalTrials.gov (NCT03633773) Safety and Efficacy Evaluation of MUC-1 CART in the Treatment of Intrahepatic Cholangiocarcinoma | |||||
| REF 21 | ClinicalTrials.gov (NCT03222674) Multi-CAR T Cell Therapy for Acute Myeloid Leukemia | |||||
| REF 22 | Clinical pipeline report, company report or official report of Quest PharmaTech. | |||||
| REF 23 | ClinicalTrials.gov (NCT03198052) HER2/Mesothelin/Lewis-Y/PSCA/MUC1/PD-L1/CD80/86-CAR-T Cells Immunotherapy Against Cancers | |||||
| REF 24 | ClinicalTrials.gov (NCT03267173) Evaluate the Safety and Efficacy of CAR-T in the Treatment of Pancreatic Cancer. | |||||
| REF 25 | ClinicalTrials.gov (NCT03291444) CAR-T Cells Combined With Peptide Specific Dendritic Cell in Relapsed/Refractory Leukemia/MDS | |||||
| REF 26 | ClinicalTrials.gov (NCT04020575) Autologous huMNC2-CAR44 T Cells for Breast Cancer Targeting Cleaved Form of MUC1 (MUC1*). U.S. National Institutes of Health. | |||||
| REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800041064) | |||||
| REF 28 | ClinicalTrials.gov (NCT01556789) Phase 1 Study of ONT-10 in Patients With Solid Tumors. U.S. National Institutes of Health. | |||||
| REF 29 | ClinicalTrials.gov (NCT04025216) A Study of CART-TnMUC1 in Patients With TnMUC1-Positive Advanced Cancers. U.S. National Institutes of Health. | |||||
| REF 30 | ClinicalTrials.gov (NCT03473457) CAR-T Cells Therapy in Relapsed/Refractory Acute Myeloid Leukemia | |||||
| REF 31 | Emepepimut-S for non-small cell lung cancer. Expert Opin Biol Ther. 2011 Aug;11(8):1091-7. | |||||
| REF 32 | Clinical pipeline report, company report or official report of Genus Oncology. | |||||
| REF 33 | The role of epithelial antigens in diagnosis and staging of breast cancer. Arkh Patol. 2002 Nov-Dec;64(6):13-5. | |||||
| REF 34 | Early in vivo signaling profiles in MUC1-specific CD4+ T cells responding to two different MUC1-targeting vaccines in two different microenvironments. Oncoimmunology. 2013 Mar 1;2(3):e23429. | |||||
| REF 35 | Staining of MUC1 in ovarian cancer tissues with PankoMab-GEX detecting the tumour-associated epitope, TA-MUC1, as compared to antibodies HMFG-1 and 115D8. Histol Histopathol. 2013 Feb;28(2):239-44. | |||||
| REF 36 | Integrating in vitro signaling and drug response data from single cell network profiling (SCNP) to inform on individual's AML biology.Molecular Cancer Therapeutics. 11/2011; 10(Supplement 1):A73-A73. | |||||
| REF 37 | Phase I trial of a murine antibody to MUC1 in patients with metastatic cancer: evidence for the activation of humoral and cellular antitumor immunity. Ann Oncol. 2004 Dec;15(12):1825-33. | |||||
| REF 38 | ClinicalTrials.gov (NCT03170141) Immunogene-modified T (IgT) Cells Against Glioblastoma Multiforme | |||||
| REF 39 | Phase I/II study exploring ImMucin, a pan-major histocompatibility complex, anti-MUC1 signal peptide vaccine, in multiple myeloma patients. Br J Haematol. 2015 Apr;169(1):44-56. | |||||
| REF 40 | Characterization of an anti-MUC1 monoclonal antibody with potential as a cancer vaccine. Hybrid Hybridomics. 2001;20(5-6):313-24. | |||||
| REF 41 | Clinical pipeline report, company report or official report of Minerva Biotechnologies. | |||||
| REF 42 | Dendritic cell vaccine immunotherapy of cancer targeting MUC1 mucin. Int J Mol Med. 2003 Oct;12(4):493-502. | |||||
| REF 43 | Clinical pipeline report, company report or official report of Oncothyreon. | |||||
| REF 44 | Technology evaluation: TG-1031, Transgene SA.Curr Opin Mol Ther.2000 Feb;2(1):106-11. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.