Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T25005
(Former ID: TTDR00233)
|
|||||
Target Name |
Tyrosine-protein kinase BTK (ATK)
|
|||||
Synonyms |
Bruton's tyrosine kinase; Bruton tyrosine kinase; BPK; B-cell progenitor kinase; B cell progenitor kinase; Agammaglobulinemia tyrosine kinase; Agammaglobulinaemia tyrosine kinase; AGMX1
|
|||||
Gene Name |
BTK
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Mature B-cell lymphoma [ICD-11: 2A85] | |||||
Function |
Binding of antigen to the B-cell antigen receptor (BCR) triggers signaling that ultimately leads to B-cell activation. After BCR engagement and activation at the plasma membrane, phosphorylates PLCG2 at several sites, igniting the downstream signaling pathway through calcium mobilization, followed by activation of the protein kinase C (PKC) family members. PLCG2 phosphorylation is performed in close cooperation with the adapter protein B-cell linker protein BLNK. BTK acts as a platform to bring together a diverse array of signaling proteins and is implicated in cytokine receptor signaling pathways. Plays an important role in the function of immune cells of innate as well as adaptive immunity, as a component of the Toll-like receptors (TLR) pathway. The TLR pathway acts as a primary surveillance system for the detection of pathogens and are crucial to the activation of host defense. Especially, is a critical molecule in regulating TLR9 activation in splenic B-cells. Within the TLR pathway, induces tyrosine phosphorylation of TIRAP which leads to TIRAP degradation. BTK plays also a critical role in transcription regulation. Induces the activity of NF-kappa-B, which is involved in regulating the expression of hundreds of genes. BTK is involved on the signaling pathway linking TLR8 and TLR9 to NF-kappa-B. Transiently phosphorylates transcription factor GTF2I on tyrosine residues in response to BCR. GTF2I then translocates to the nucleus to bind regulatory enhancer elements to modulate gene expression. ARID3A and NFAT are other transcriptional target of BTK. BTK is required for the formation of functional ARID3A DNA-binding complexes. There is however no evidence that BTK itself binds directly to DNA. BTK has a dual role in the regulation of apoptosis. Non-receptor tyrosine kinase indispensable for B lymphocyte development, differentiation and signaling.
Click to Show/Hide
|
|||||
BioChemical Class |
Kinase
|
|||||
UniProt ID | ||||||
EC Number |
EC 2.7.10.2
|
|||||
Sequence |
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS HRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDE YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK EGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER FTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T58FWN |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 3 Approved Drugs | + | ||||
1 | Acalabrutinib | Drug Info | Approved | Mantle cell lymphoma | [2] | |
2 | Ibrutinib | Drug Info | Approved | Mantle cell lymphoma | [3], [4], [5] | |
3 | Zanubrutinib | Drug Info | Approved | Mantle cell lymphoma | [6] | |
Clinical Trial Drug(s) | [+] 26 Clinical Trial Drugs | + | ||||
1 | GDC-0853 | Drug Info | Phase 3 | Multiple sclerosis | [7] | |
2 | ICP-022 | Drug Info | Phase 3 | Chronic lymphocytic leukaemia | [8] | |
3 | Pirtobrutinib | Drug Info | Phase 3 | Chronic lymphocytic leukaemia | [9] | |
4 | ARQ 531 | Drug Info | Phase 2 | Hematologic tumour | [10] | |
5 | BGB-3112 | Drug Info | Phase 2 | Follicular lymphoma | [11] | |
6 | BMS-986142 | Drug Info | Phase 2 | Rheumatoid arthritis | [12] | |
7 | CC-292 | Drug Info | Phase 2 | Chronic lymphocytic leukaemia | [13] | |
8 | DTRM-555 | Drug Info | Phase 2 | Chronic lymphocytic leukaemia | [14] | |
9 | GS-4059 | Drug Info | Phase 2 | B-cell lymphoma | [11] | |
10 | LOU064 | Drug Info | Phase 2 | Chronic idiopathic urticaria | [15] | |
11 | M2951 | Drug Info | Phase 2 | Multiple sclerosis | [16] | |
12 | PRN1008 | Drug Info | Phase 2 | Pemphigus vulgaris | [12], [15] | |
13 | ACP-319 | Drug Info | Phase 1/2 | Chronic lymphocytic leukaemia | [17] | |
14 | CG-806 | Drug Info | Phase 1/2 | Acute myeloid leukaemia | [18] | |
15 | Vecabrutinib | Drug Info | Phase 1/2 | B-cell lymphoma | [11] | |
16 | AC0058TA | Drug Info | Phase 1 | Autoimmune disease | [12] | |
17 | BGB-3113 | Drug Info | Phase 1 | B-cell lymphoma | [11] | |
18 | BIIB068 | Drug Info | Phase 1 | Systemic lupus erythematosus | [12] | |
19 | DTRMWXHS-12 | Drug Info | Phase 1 | B-cell lymphoma | [11] | |
20 | HM71224 | Drug Info | Phase 1 | Rheumatoid arthritis | [19] | |
21 | JNJ-64264681 | Drug Info | Phase 1 | Non-hodgkin lymphoma | [20] | |
22 | M7583 | Drug Info | Phase 1 | Haematological malignancy | [11] | |
23 | ONO-4059 | Drug Info | Phase 1 | B-cell lymphoma | [21] | |
24 | PRN2246 | Drug Info | Phase 1 | Multiple sclerosis | [16] | |
25 | TAK-020 | Drug Info | Phase 1 | Rheumatoid arthritis | [12] | |
26 | TG-1701 | Drug Info | Phase 1 | Non-hodgkin lymphoma | [22] | |
Patented Agent(s) | [+] 2 Patented Agents | + | ||||
1 | Pyrrolo[2,3-d]pyrimidine derivative 16 | Drug Info | Patented | Solid tumour/cancer | [23] | |
2 | Pyrrolo[2,3-d]pyrimidine derivative 17 | Drug Info | Patented | Solid tumour/cancer | [23] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | PCI-45292 | Drug Info | Preclinical | Autoimmune diabetes | [24] | |
Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
1 | GDC-0834 | Drug Info | Terminated | Rheumatoid arthritis | [25] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Inhibitor | [+] 62 Inhibitor drugs | + | ||||
1 | Acalabrutinib | Drug Info | [2] | |||
2 | Ibrutinib | Drug Info | [26] | |||
3 | Zanubrutinib | Drug Info | [6] | |||
4 | GDC-0853 | Drug Info | [12] | |||
5 | ICP-022 | Drug Info | [27] | |||
6 | Pirtobrutinib | Drug Info | [28] | |||
7 | ARQ 531 | Drug Info | [11] | |||
8 | BGB-3112 | Drug Info | [11] | |||
9 | BMS-986142 | Drug Info | [12] | |||
10 | DTRM-555 | Drug Info | [14] | |||
11 | GS-4059 | Drug Info | [11], [12] | |||
12 | LOU064 | Drug Info | [15] | |||
13 | M2951 | Drug Info | [12], [16] | |||
14 | PRN1008 | Drug Info | [12], [15] | |||
15 | ACP-319 | Drug Info | [26] | |||
16 | CG-806 | Drug Info | [29] | |||
17 | Vecabrutinib | Drug Info | [11] | |||
18 | AC0058TA | Drug Info | [12] | |||
19 | BGB-3113 | Drug Info | [11] | |||
20 | BIIB068 | Drug Info | [12] | |||
21 | DTRMWXHS-12 | Drug Info | [30] | |||
22 | HM71224 | Drug Info | [31] | |||
23 | JNJ-64264681 | Drug Info | [32] | |||
24 | M7583 | Drug Info | [11] | |||
25 | PRN2246 | Drug Info | [16] | |||
26 | TAK-020 | Drug Info | [12] | |||
27 | TG-1701 | Drug Info | [34] | |||
28 | Imidazopyridine derivative 4 | Drug Info | [35] | |||
29 | PMID27774824-Compound-Figure12Example1 | Drug Info | [35] | |||
30 | PMID27774824-Compound-Figure12Example10 | Drug Info | [35] | |||
31 | PMID27774824-Compound-Figure12Example61 | Drug Info | [35] | |||
32 | Pyrazolo[4,3-c]pyridine derivative 2 | Drug Info | [35] | |||
33 | Pyrrolo[2,3-d]pyrimidine derivative 12 | Drug Info | [23] | |||
34 | Pyrrolo[2,3-d]pyrimidine derivative 13 | Drug Info | [23] | |||
35 | Pyrrolo[2,3-d]pyrimidine derivative 14 | Drug Info | [23] | |||
36 | Pyrrolo[2,3-d]pyrimidine derivative 15 | Drug Info | [23] | |||
37 | Pyrrolo[2,3-d]pyrimidine derivative 16 | Drug Info | [23] | |||
38 | Pyrrolo[2,3-d]pyrimidine derivative 17 | Drug Info | [23] | |||
39 | Pyrrolo[2,3-d]pyrimidine derivative 18 | Drug Info | [23] | |||
40 | Pyrrolo[2,3-d]pyrimidine derivative 19 | Drug Info | [23] | |||
41 | Pyrrolo[2,3-d]pyrimidine derivative 20 | Drug Info | [23] | |||
42 | Pyrrolo[2,3-d]pyrimidine derivative 21 | Drug Info | [23] | |||
43 | Pyrrolo[2,3-d]pyrimidine derivative 22 | Drug Info | [23] | |||
44 | Pyrrolo[2,3-d]pyrimidine derivative 23 | Drug Info | [23] | |||
45 | Pyrrolo[2,3-d]pyrimidine derivative 25 | Drug Info | [23] | |||
46 | Pyrrolo[2,3-d]pyrimidine derivative 26 | Drug Info | [23] | |||
47 | Pyrrolo[2,3-d]pyrimidine derivative 27 | Drug Info | [23] | |||
48 | Pyrrolo[2,3-d]pyrimidine derivative 28 | Drug Info | [23] | |||
49 | Pyrrolo[2,3-d]pyrimidine derivative 29 | Drug Info | [23] | |||
50 | Pyrrolo[2,3-d]pyrimidine derivative 30 | Drug Info | [23] | |||
51 | Pyrrolo[2,3-d]pyrimidine derivative 31 | Drug Info | [23] | |||
52 | Pyrrolo[2,3-d]pyrimidine derivative 32 | Drug Info | [23] | |||
53 | Pyrrolo[2,3-d]pyrimidine derivative 33 | Drug Info | [23] | |||
54 | PCI-45292 | Drug Info | [36] | |||
55 | GDC-0834 | Drug Info | [25] | |||
56 | CGI-1316 | Drug Info | [26] | |||
57 | Inositol 1,3,4,5-Tetrakisphosphate | Drug Info | [37] | |||
58 | LFM-A13 | Drug Info | [38] | |||
59 | PMID24900538C2c | Drug Info | [39] | |||
60 | PMID24915291C31 | Drug Info | [40] | |||
61 | PMID24915291C38 | Drug Info | [40] | |||
62 | RN486 | Drug Info | [41] | |||
Modulator | [+] 2 Modulator drugs | + | ||||
1 | CC-292 | Drug Info | [13] | |||
2 | ONO-4059 | Drug Info | [33] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) | ||||||
Drug Resistance Mutation (DRM) |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Ibrutinib (PCI-32765), the first BTK (Bruton's tyrosine kinase) inhibitor in clinical trials. Curr Hematol Malig Rep. 2013 Mar;8(1):1-6. | |||||
REF 2 | 2017 FDA drug approvals.Nat Rev Drug Discov. 2018 Feb;17(2):81-85. | |||||
REF 3 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6912). | |||||
REF 4 | Janssen's IMBRUVICA (ibrutinib) Receives Additional European Commission Approval for the Treatment of Waldenstrom's Macroglobulinemia. Janssen-Cilag International NV (Janssen). Jul 10, 2015. | |||||
REF 5 | ClinicalTrials.gov (NCT01833039) An Open Label Treatment Use Protocol for Ibrutinib in Subjects With Relapsed or Refractory Mantle Cell Lymphoma. U.S. National Institutes of Health. | |||||
REF 6 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019 | |||||
REF 7 | ClinicalTrials.gov (NCT04586023) Study To Evaluate The Efficacy And Safety Of Fenebrutinib Compared With Teriflunomide In Relapsing Multiple Sclerosis (RMS) (FENhance). U.S. National Institutes of Health. | |||||
REF 8 | ClinicalTrials.gov (NCT04578613) ICP-022 Versus Chlorambucil Combined With Rituximab in the Treatment of Untreated CLL/SLL. U.S. National Institutes of Health. | |||||
REF 9 | ClinicalTrials.gov (NCT04666038) Study of LOXO-305 Versus Investigator's Choice (IdelaR or BR) in Patients With CLL or SLL. U.S. National Institutes of Health. | |||||
REF 10 | ClinicalTrials.gov (NCT04728893) Efficacy and Safety of MK-1026 in Participants With Hematologic Malignancies (MK-1026-003). U.S. National Institutes of Health. | |||||
REF 11 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 12 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 13 | Inhibition of Btk with CC-292 provides early pharmacodynamic assessment of activity in mice and humans. J Pharmacol Exp Ther. 2013 Aug;346(2):219-28. | |||||
REF 14 | ClinicalTrials.gov (NCT04305444) Study of a Triple Combination Therapy, DTRM-555, in Patients With R/R CLL or R/R Non-Hodgkin's Lymphomas. U.S. National Institutes of Health. | |||||
REF 15 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 16 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 17 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800040955) | |||||
REF 18 | ClinicalTrials.gov (NCT04477291) A Study of CG-806 in Patients With Relapsed or Refractory Acute Myeloid Leukemia. U.S. National Institutes of Health. | |||||
REF 19 | ClinicalTrials.gov (NCT01765478) Safety,PK/PD, Food Effect Study of Orally Administered HM71224 in Healthy Adult Male Volunteers. U.S. National Institutes of Health. | |||||
REF 20 | ClinicalTrials.gov (NCT04210219) A Study of JNJ-64264681 in Participants With Non-Hodgkin Lymphoma and Chronic Lymphocytic Leukemia. U.S. National Institutes of Health. | |||||
REF 21 | ClinicalTrials.gov (NCT01659255) Phase I Study of ONO-4059 Given as Monotherapy in Patients With Relapsed/Refractory NHL and CLL. U.S. National Institutes of Health. | |||||
REF 22 | ClinicalTrials.gov (NCT03671590) Study of TG-1701, an Irreversible Bruton's Tyrosine Kinase Inhibitor, in Patients With B-Cell Malignancies. U.S. National Institutes of Health. | |||||
REF 23 | Pyrrolo[2,3-d]pyrimidines active as Btk inhibitors.Expert Opin Ther Pat. 2017 Dec;27(12):1305-1318. | |||||
REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029717) | |||||
REF 25 | Antiarthritis effect of a novel Bruton's tyrosine kinase (BTK) inhibitor in rat collagen-induced arthritis and mechanism-based pharmacokinetic/pharmacodynamic modeling: relationships between inhibition of BTK phosphorylation and efficacy. J Pharmacol Exp Ther. 2011 Jul;338(1):154-63. | |||||
REF 26 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1948). | |||||
REF 27 | Clinical pipeline report, company report or official report of InnoCare Pharma. | |||||
REF 28 | Targeting BTK in CLL: Beyond Ibrutinib. Curr Hematol Malig Rep. 2019 Jun;14(3):197-205. | |||||
REF 29 | Clinical pipeline report, company report or official report of Aptose Biosciences. | |||||
REF 30 | ClinicalTrials.gov (NCT02900716) Safety Study of BTK Inhibitor, DTRMWXHS-12, Used Singly or in Combination, in CLL and B-cell Lymphomas. U.S. National Institutes of Health. | |||||
REF 31 | HM71224, a selective Bruton's tyrosine kinase inhibitor, attenuates the development of murine lupus. Arthritis Res Ther. 2017 Sep 26;19(1):211. | |||||
REF 32 | A Study of JNJ-64264681 and JNJ-67856633 in Participants With Non-Hodgkin Lymphoma and Chronic Lymphocytic Leukemia | |||||
REF 33 | ONO-4059, a novel oral Bruton's tyrosine kinase (Btk) inhibitor that demonstrates potent pharmacodynamic activity through Phosphorylated Btk (P-Btk) inhibition, in addition to effective anti-tumour activity in a TMD-8 (DLBCL) xenograft model. Cancer Research. 08/2013; 73(8 Supplement):2452-2452. | |||||
REF 34 | Clinical pipeline report, company report or official report of TG Therapeutics. | |||||
REF 35 | Inhibitors of JAK-family kinases: an update on the patent literature 2013-2015, part 1.Expert Opin Ther Pat. 2017 Feb;27(2):127-143. | |||||
REF 36 | Ibrutinib is an irreversible molecular inhibitor of ITK driving a Th1-selective pressure in T lymphocytes. Blood. 2013 October 10; 122(15): 2539-2549. | |||||
REF 37 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
REF 38 | A systematic interaction map of validated kinase inhibitors with Ser/Thr kinases. Proc Natl Acad Sci U S A. 2007 Dec 18;104(51):20523-8. | |||||
REF 39 | Discovery of Disubstituted Imidazo[4,5-b]pyridines and Purines as Potent TrkA Inhibitors. ACS Med Chem Lett. 2012 Jul 26;3(9):705-9. | |||||
REF 40 | Discovery of a series of 2,5-diaminopyrimidine covalent irreversible inhibitors of Bruton's tyrosine kinase with in vivo antitumor activity. J Med Chem. 2014 Jun 26;57(12):5112-28. | |||||
REF 41 | RN486, a selective Bruton's tyrosine kinase inhibitor, abrogates immune hypersensitivity responses and arthritis in rodents. J Pharmacol Exp Ther. 2012 Apr;341(1):90-103. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.