Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T25076
(Former ID: TTDR00412)
|
|||||
Target Name |
Endothelin-1 (EDN1)
|
|||||
Synonyms |
Preproendothelin-1; PPET1
|
|||||
Gene Name |
EDN1
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Dissociative neurological symptom disorder [ICD-11: 6B60] | |||||
Function |
Endothelins are endothelium-derived vasoconstrictor peptides.
Click to Show/Hide
|
|||||
BioChemical Class |
Endothelin/sarafotoxin
|
|||||
UniProt ID | ||||||
Sequence |
MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCW NFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSE TMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A02149 ; BADD_A02564 ; BADD_A02600 | |||||
HIT2.0 ID | T93VFT |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
1 | Tetramethylpyrazine | Drug Info | Discontinued in Phase 2 | Neurological disorder | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | Tetramethylpyrazine | Drug Info | [3] |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-regulating Transcription Factors |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Predictive value of biomarkers in patients with heart failure. Curr Med Chem. 2012;19(16):2534-47. | |||||
REF 2 | Determination of tetramethylpyrazine in animal serum and cerebrospinal fluid by high performance liquid chromatography. Se Pu. 2000 Jan;18(1):46-8. | |||||
REF 3 | Tetramethylpyrazine, a Chinese drug, blocks coronary vasoconstriction by endothelin-1 and decreases plasma endothelin-1 levels in experimental animals. J Cardiovasc Pharmacol. 1998;31 Suppl 1:S313-6. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.