Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T25076
(Former ID: TTDR00412)
|
|||||
| Target Name |
Endothelin-1 (EDN1)
|
|||||
| Synonyms |
Preproendothelin-1; PPET1
|
|||||
| Gene Name |
EDN1
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Dissociative neurological symptom disorder [ICD-11: 6B60] | |||||
| Function |
Endothelins are endothelium-derived vasoconstrictor peptides.
Click to Show/Hide
|
|||||
| BioChemical Class |
Endothelin/sarafotoxin
|
|||||
| UniProt ID | ||||||
| Sequence |
MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCW NFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSE TMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| ADReCS ID | BADD_A02149 ; BADD_A02564 ; BADD_A02600 | |||||
| HIT2.0 ID | T93VFT | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | Tetramethylpyrazine | Drug Info | Discontinued in Phase 2 | Neurological disorder | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | Tetramethylpyrazine | Drug Info | [3] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-regulating Transcription Factors | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Predictive value of biomarkers in patients with heart failure. Curr Med Chem. 2012;19(16):2534-47. | |||||
| REF 2 | Determination of tetramethylpyrazine in animal serum and cerebrospinal fluid by high performance liquid chromatography. Se Pu. 2000 Jan;18(1):46-8. | |||||
| REF 3 | Tetramethylpyrazine, a Chinese drug, blocks coronary vasoconstriction by endothelin-1 and decreases plasma endothelin-1 levels in experimental animals. J Cardiovasc Pharmacol. 1998;31 Suppl 1:S313-6. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.