Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T29774
(Former ID: TTDR00422)
|
|||||
Target Name |
Leukemia inhibitory factor (LIF)
|
|||||
Synonyms |
Melanoma-derived LPL inhibitor; MLPLI; HILDA; Emfilermin; Differentiation-stimulating factor; D factor
|
|||||
Gene Name |
LIF
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
Function |
Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes. LIF has the capacity to induce terminal differentiation in leukemic cells.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNIT RDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQK KKLGCQLLGKYKQIIAVLAQAF Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
HIT2.0 ID | T21XA6 |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | MSC-1 | Drug Info | Phase 1 | Solid tumour/cancer | [2] |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Biomarkers in psoriasis and psoriatic arthritis. Ann Rheum Dis. 2013 Apr;72 Suppl 2:ii104-10. | |||||
REF 2 | ClinicalTrials.gov (NCT03490669) Study to Evaluate Safety, PK, PD, Immunogenicity & Antitumor Activity of MSC-1 in Patients With Adv Solid Tumors. U.S. National Institutes of Health. | |||||
REF 3 | National Cancer Institute Drug Dictionary (drug name MSC-1). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.