Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T30040
(Former ID: TTDR00926)
|
|||||
Target Name |
Vascular endothelial growth factor B (VEGFB)
|
|||||
Synonyms |
VRF; VEGF-related factor; VEGF-B
|
|||||
Gene Name |
VEGFB
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Colorectal cancer [ICD-11: 2B91] | |||||
Function |
VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis. Growth factor for endothelial cells.
Click to Show/Hide
|
|||||
BioChemical Class |
Growth factor
|
|||||
UniProt ID | ||||||
Sequence |
MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVEL
MGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS QCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAP STTSALTPGPAAAAADAAASSVAKGGA Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
1 | Aflibercept | Drug Info | Approved | Metastatic colorectal cancer | [1] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | Aflibercept | Drug Info | [1] |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 6 KEGG Pathways | + | ||||
1 | Ras signaling pathway | |||||
2 | Rap1 signaling pathway | |||||
3 | Cytokine-cytokine receptor interaction | |||||
4 | PI3K-Akt signaling pathway | |||||
5 | Focal adhesion | |||||
6 | Pathways in cancer | |||||
NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
1 | TSH Signaling Pathway | |||||
PID Pathway | [+] 1 PID Pathways | + | ||||
1 | VEGFR1 specific signals | |||||
Reactome | [+] 3 Reactome Pathways | + | ||||
1 | Platelet degranulation | |||||
2 | VEGF ligand-receptor interactions | |||||
3 | VEGF binds to VEGFR leading to receptor dimerization | |||||
WikiPathways | [+] 3 WikiPathways | + | ||||
1 | Focal Adhesion | |||||
2 | Signaling by VEGF | |||||
3 | Heart Development |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.