Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T30790
(Former ID: TTDC00342)
|
|||||
Target Name |
Calcium-release activated calcium channel (CRACM)
|
|||||
Synonyms |
Transmembrane protein 142A; TMEM142A; Protein orai-1; Calcium release-activated calcium channel protein 1; CRACM1
|
|||||
Gene Name |
ORAI1
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Malignant haematopoietic neoplasm [ICD-11: 2B33] | |||||
Function |
CRAC channels are the main pathway for Ca(2+) influx in T-cells and promote the immune response to pathogens by activating the transcription factor NFAT. Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores and channel activation by the Ca(2+) sensor, STIM1.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSY
SEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLL IAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFST VIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIAST TIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHY A Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T45LZI |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | RP4010 | Drug Info | Phase 1 | Non-hodgkin lymphoma | [1] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Inhibitor | [+] 1 Inhibitor drugs | + | ||||
1 | RP4010 | Drug Info | [1] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 4 KEGG Pathways | + | ||||
1 | Calcium signaling pathway | |||||
2 | cAMP signaling pathway | |||||
3 | Platelet activation | |||||
4 | Primary immunodeficiency | |||||
PID Pathway | [+] 4 PID Pathways | + | ||||
1 | TCR signaling in naï | |||||
2 | ||||||
3 | TCR signaling in naï | |||||
4 | ||||||
Reactome | [+] 1 Reactome Pathways | + | ||||
1 | Antigen activates B Cell Receptor (BCR) leading to generation of second messengers | |||||
WikiPathways | [+] 2 WikiPathways | + | ||||
1 | Signaling by the B Cell Receptor (BCR) | |||||
2 | Platelet homeostasis |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.