Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T35289
(Former ID: TTDI02343)
|
|||||
| Target Name |
NKG2 D activating NK receptor (KLRK1)
|
|||||
| Synonyms |
NKG2Dactivating NK receptor; NKG2D type II integral membrane protein; NKG2D; NKG2-D-activating NK receptor; NKG2-D type II integral membrane protein; NK cell receptor D; Killer cell lectinlike receptor subfamily K member 1; Killer cell lectin-like receptor subfamily K member 1; D12S2489E; CD314
|
|||||
| Gene Name |
KLRK1
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 5 Target-related Diseases | + | ||||
| 1 | Crohn disease [ICD-11: DD70] | |||||
| 2 | Acute myeloid leukaemia [ICD-11: 2A60] | |||||
| 3 | Colorectal cancer [ICD-11: 2B91] | |||||
| 4 | Multiple myeloma [ICD-11: 2A83] | |||||
| 5 | Myelodysplastic syndrome [ICD-11: 2A37] | |||||
| Function |
Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8(+) T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4. Function as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIA
VAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNW YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLT IIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 5 Clinical Trial Drugs | + | ||||
| 1 | NN8555 | Drug Info | Phase 2 | Crohn disease | [1] | |
| 2 | CM-CS1 T-cell | Drug Info | Phase 1 | Multiple myeloma | [2] | |
| 3 | CYAD-101 | Drug Info | Phase 1 | Colorectal cancer | [3] | |
| 4 | NKR-2 CAR-T Cells | Drug Info | Phase 1 | Myelodysplastic syndrome | [4] | |
| 5 | NKR-2 cells | Drug Info | Phase 1 | Acute myeloid leukaemia | [5], [6] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Antagonist | [+] 1 Antagonist drugs | + | ||||
| 1 | NN8555 | Drug Info | [1] | |||
| CAR-T-Cell-Therapy | [+] 4 CAR-T-Cell-Therapy drugs | + | ||||
| 1 | CM-CS1 T-cell | Drug Info | [2] | |||
| 2 | CYAD-101 | Drug Info | [3] | |||
| 3 | NKR-2 CAR-T Cells | Drug Info | [4] | |||
| 4 | NKR-2 cells | Drug Info | [5], [6] | |||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 2 | ClinicalTrials.gov (NCT02203825) Safety Study of Chimeric Antigen Receptor Modified T-cells Targeting NKG2D-Ligands | |||||
| REF 3 | ClinicalTrials.gov (NCT03692429) alloSHRINK - Standard cHemotherapy Regimen and Immunotherapy With Allogeneic NKG2D-based CYAD-101 Chimeric Antigen Receptor T-cells | |||||
| REF 4 | ClinicalTrials.gov (NCT03612739) EPITHINK: Epigenetic Drug Treatment and Therapeutic Immunotherapy With NKR-2 | |||||
| REF 5 | ClinicalTrials.gov (NCT03310008) Dose Escalation and Dose Expansion Phase I Study to Assess the Safety and Clinical Activity of Multiple Doses of NKR-2 Administered Concurrently With FOLFOX in Colorectal Cancer With Potentially Resectable Liver Metastases | |||||
| REF 6 | ClinicalTrials.gov (NCT03370198) Hepatic Transarterial Administrations of NKR-2 in Patients With Unresectable Liver Metastases From Colorectal Cancer | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.