Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T37434
(Former ID: TTDI02154)
|
|||||
Target Name |
Prominin-1 (PROM1)
|
|||||
Synonyms |
Promininlike protein 1; Prominin1; Prominin-like protein 1; PROML1; MSTP061; CD133; Antigen AC133
Click to Show/Hide
|
|||||
Gene Name |
PROM1
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 6 Target-related Diseases | + | ||||
1 | Brain cancer [ICD-11: 2A00] | |||||
2 | Colorectal cancer [ICD-11: 2B91] | |||||
3 | Liver cancer [ICD-11: 2C12] | |||||
4 | Ovarian cancer [ICD-11: 2C73] | |||||
5 | Pancreatic cancer [ICD-11: 2C10] | |||||
6 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
Function |
Binds cholesterol in cholesterol-containing plasma membrane microdomains and may play a role in the organization of the apical plasma membrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner. May play a role in cell differentiation, proliferation and apoptosis.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MALVLGSLLLLGLCGNSFSGGQPSSTDAPKAWNYELPATNYETQDSHKAGPIGILFELVH
IFLYVVQPRDFPEDTLRKFLQKAYESKIDYDKPETVILGLKIVYYEAGIILCCVLGLLFI ILMPLVGYFFCMCRCCNKCGGEMHQRQKENGPFLRKCFAISLLVICIIISIGIFYGFVAN HQVRTRIKRSRKLADSNFKDLRTLLNETPEQIKYILAQYNTTKDKAFTDLNSINSVLGGG ILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRS SLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQG YQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYI HRNLPTLEEYDSYWWLGGLVICSLLTLIVIFYYLGLLCGVCGYDRHATPTTRGCVSNTGG VFLMVGVGLSFLFCWILMIIVVLTFVFGANVEKLICEPYTSKELFRVLDTPYLLNEDWEY YLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELES LKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANS LPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASL DFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVD VFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDVYDDVETIPMKNME NGNNGYHKDHVYGIHNPVMTSPSQH Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T65CPM |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | Anti-CD133-CAR vector-transduced T cells | Drug Info | Phase 1 | Brain cancer | [2] | |
2 | ICT-121 | Drug Info | Phase 1 | Solid tumour/cancer | [3] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | CAR-T cells targeting CD133 | Drug Info | Preclinical | Acute myeloid leukaemia | [4] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
CAR-T-Cell-Therapy | [+] 2 CAR-T-Cell-Therapy drugs | + | ||||
1 | Anti-CD133-CAR vector-transduced T cells | Drug Info | [2] | |||
2 | CAR-T cells targeting CD133 | Drug Info | [4] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Tissue Distribution
of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.
The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects
(Nat Rev Drug Discov, 20: 64-81, 2021).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Tissue Distribution
Biological Network Descriptors
|
There is no similarity protein (E value < 0.005) for this target
|
Note:
If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.
|
Degree | 2 | Degree centrality | 2.15E-04 | Betweenness centrality | 2.02E-04 |
---|---|---|---|---|---|
Closeness centrality | 2.00E-01 | Radiality | 1.35E+01 | Clustering coefficient | 0.00E+00 |
Neighborhood connectivity | 1.05E+01 | Topological coefficient | 5.00E-01 | Eccentricity | 12 |
Download | Click to Download the Full PPI Network of This Target | ||||
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
1 | Transcriptional misregulation in cancer | |||||
WikiPathways | [+] 2 WikiPathways | + | ||||
1 | Extracellular vesicle-mediated signaling in recipient cells | |||||
2 | Hair Follicle Development: Cytodifferentiation (Part 3 of 3) |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Immunotargeting of cancer stem cells. Contemp Oncol (Pozn) 2015; 19(1A): A52-A59. | |||||
REF 2 | ClinicalTrials.gov (NCT02541370) Treatment of Relapsed and/or Chemotherapy Refractory Advanced Malignancies by CART133 | |||||
REF 3 | ClinicalTrials.gov (NCT02049489) A Study of ICT-121 Dendritic Cell Vaccine in Recurrent Glioblastoma. U.S. National Institutes of Health. | |||||
REF 4 | ClinicalTrials.gov (NCT03473457) CAR-T Cells Therapy in Relapsed/Refractory Acute Myeloid Leukemia |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.