Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T37986
(Former ID: TTDR00027)
|
|||||
Target Name |
Streptomyces RNA methyltransferase (Stre-myc carB)
|
|||||
Synonyms |
carB; RNA methyltransferase
Click to Show/Hide
|
|||||
Gene Name |
Stre-myc carB
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
Probable RNA methylase. Confers resistance to carbomycin and several other macrolides, lincomycin and vernamycin B, but not to all macrolide-lincosamide-streptogramin B antibiotics.
Click to Show/Hide
|
|||||
BioChemical Class |
Methyltransferase
|
|||||
UniProt ID | ||||||
EC Number |
EC 2.1.1.-
|
|||||
Sequence |
MAALLKRILRRRMAEKRSGRGRMAAARTTGAQSRKTAQRSGRSEADRRRRVHGQNFLVDR
ETVQRFVRFADPDPGEVVLEVGAGNGAITRELARLCRRVVAYEIDRHFADRLREATAEDP RIEVVAGDFLKTSQPKVPFSVVGNIPFGNTADIVDWCLNARRLRTTTLVTQLEYARKRTG GYRRWSRLTVATWPEVEWRMGERISRRWFRPVPAVDSAVLRLERRPVPLIPPGLMHDFRD LVETGFTGKGGSLDASLRRRFPARRVAAGFRRARLEQGVVVAYVTPGQWITLFEELHGR Click to Show/Hide
|
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | The effect of sinefungin and synthetic analogues on RNA and DNA methyltransferases from Streptomyces. J Antibiot (Tokyo). 1991 Oct;44(10):1141-7. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.